SecReT6
Protein ID: 383758429
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25760
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2712636..2713151 [-]
Producthypothetical protein
NoteTssB
UniProt IDI0HSC8
KEGG IDrge:RGE_25760
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.30E-57, Aligned region: 11..167
Protein Sequence: 171 a.a.     [Download]
>gi|383758429|ref|YP_005437414.1| hypothetical protein RGE_25760 [Rubrivivax gelatinosus IL144]
MAKKESVQKRLEKIRPPRVQLTYDVEVGDAIEQKELPFVVGVLGDFTGKQDPAKPLPKLKDRKFVNVDLD
NFDDVLKGMAPQASYRVKNTLSEEGGEFAVNLRFDKFDDFRPEAVVQQVEPLRKLLEARAKLADLRNKLA
GNEKLEDLLGEVLRNTEQLHMLGTETQSSGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2713151-2712636 Rubrivivax gelatinosus IL144, complete genome
ATGGCCAAGAAAGAGAGCGTCCAAAAGCGCCTCGAGAAGATTCGCCCGCCTCGCGTGCAACTCACCTACG
ACGTCGAAGTGGGTGATGCGATCGAGCAGAAGGAACTGCCATTCGTGGTCGGCGTTCTTGGCGACTTCAC
CGGCAAGCAGGACCCGGCCAAGCCGCTGCCCAAGCTGAAGGACCGCAAGTTCGTCAACGTCGACCTCGAC
AACTTCGACGACGTCCTCAAGGGCATGGCGCCGCAGGCCTCTTACCGGGTGAAGAACACGCTCAGCGAAG
AAGGCGGAGAGTTCGCCGTGAACCTGAGGTTCGACAAGTTCGATGACTTCCGCCCCGAGGCCGTGGTCCA
ACAGGTCGAGCCGCTGAGGAAGTTGCTGGAAGCGCGCGCCAAGCTCGCCGACCTGCGCAACAAGCTCGCT
GGCAACGAGAAGCTCGAAGACCTGCTGGGCGAGGTGCTACGCAACACCGAGCAGTTGCACATGCTCGGCA
CCGAGACCCAGTCGTCCGGGGAATGA