SecReT6
Protein ID: 383758431
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25780
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2714171..2714773 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDI0HSD0
KEGG IDrge:RGE_25780
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-30, Aligned region: 16..176
Protein Sequence: 200 a.a.     [Download]
>gi|383758431|ref|YP_005437416.1| putative lipoprotein [Rubrivivax gelatinosus IL144]
MSTLKALALRASFSGAVLLTGCASSQGVLALDKPLEWLGMKKPELPPAAVIPLERKVTLRLHAGDRLNTD
SGGRSLSIVVRIYKLKDVDSFMASPLAAFQDDKAEKAAFGESLIAVREVVLTPGQKYEVVETLAPSVSNL
AVVAQFRAPADGRWRFAFSAQAAEKTGITLGLHGCAMSVATGEPVNTAPELLRLAGVHCR
 
Nucleotide Sequence: 603 bp     [Download]
>gi|383755859|ref|NC_017075.1|:2714171-2714773 Rubrivivax gelatinosus IL144, complete genome
GTGTCAACCCTCAAAGCGCTGGCTCTCAGGGCATCATTCTCGGGGGCCGTGCTGCTCACTGGCTGCGCCT
CTTCCCAGGGAGTTTTGGCACTCGACAAGCCGCTCGAATGGCTGGGGATGAAGAAGCCGGAGTTGCCGCC
AGCCGCTGTCATTCCGCTCGAACGGAAAGTGACGCTTCGCTTGCACGCAGGCGACAGACTGAACACCGAT
TCGGGGGGGCGTTCTCTTTCGATTGTTGTCAGAATTTACAAGTTGAAAGATGTTGATTCCTTCATGGCTT
CGCCGCTGGCAGCTTTCCAGGACGACAAGGCAGAGAAAGCTGCTTTCGGGGAATCGCTCATCGCGGTTCG
TGAAGTCGTGCTCACGCCCGGCCAGAAGTACGAAGTTGTGGAAACGCTCGCACCCTCGGTCTCGAACCTG
GCCGTGGTGGCGCAGTTTCGCGCGCCTGCCGATGGCCGCTGGCGCTTCGCCTTTTCCGCCCAGGCGGCTG
AGAAGACCGGCATCACACTGGGCTTGCACGGCTGCGCCATGAGCGTGGCCACCGGCGAGCCCGTGAACAC
GGCCCCCGAACTGCTGCGCCTGGCGGGGGTGCACTGCCGCTGA