SecReT6
Protein ID: 383758432
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25790
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2714794..2716143 [+]
Producthypothetical protein
NoteTssK
UniProt IDI0HSD1
KEGG IDrge:RGE_25790
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-123, Aligned region: 19..447
Protein Sequence: 449 a.a.     [Download]
>gi|383758432|ref|YP_005437417.1| hypothetical protein RGE_25790 [Rubrivivax gelatinosus IL144]
MLPSSKVLWGEGLFLRPQHFQRQDAYHEWRLAEGMRTLHPYAWGVRKCRVDTDALASGVLRFAELQIVFP
DGEMYAAPGEDDLPAPVSLATLPTGSTEFVFHAAMAPLRSAGSNSARGDAPADASTRFRQAAQDAADWFT
AAAGADVVLLKRVVRVVAEHEPREHLVSLPLLRLRRQAAGGFEYDGRFMPPCVALQASPMLVSMLRRLIE
MLQAKVDALYGFHREPSKHVIEFRSGDVASFWLLHTASSACAALTHYQHNPALHPERLFERLLELAGALM
TFSKSFTLADLPPYRHDAPGPAFLKLDTIVRELLETVISTRYFAIALAEVRPSFHVGRLDSEQITLSTTL
VLGVSAAMPAAELVDAVPLRLKVGGPDDVAKLVLSAMAGVRLVHMPQVPAAIPVRPGSYYFQFEARGPLY
ERMLQSQSVTIYVPSGIEEVRLELFALNA
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|383755859|ref|NC_017075.1|:2714794-2716143 Rubrivivax gelatinosus IL144, complete genome
GTGCTGCCATCTTCCAAAGTTCTCTGGGGTGAAGGCCTCTTCCTGCGGCCGCAACACTTCCAGCGCCAGG
ACGCCTACCACGAGTGGCGCCTGGCCGAAGGCATGCGCACGCTGCATCCGTACGCCTGGGGCGTTCGCAA
GTGCCGTGTCGACACCGACGCGCTGGCCAGCGGAGTTCTGCGTTTCGCCGAACTGCAGATCGTCTTTCCT
GACGGTGAGATGTACGCCGCGCCAGGCGAAGACGACCTGCCCGCGCCGGTCAGTCTGGCGACGCTGCCGA
CGGGCTCGACCGAGTTCGTGTTCCACGCGGCGATGGCGCCGTTGCGCAGCGCTGGCAGCAACAGCGCGCG
AGGCGATGCACCTGCCGATGCGTCTACGCGTTTTCGCCAGGCGGCTCAGGACGCGGCCGACTGGTTCACC
GCCGCGGCCGGCGCCGACGTGGTGCTGCTCAAACGCGTGGTGCGTGTCGTCGCCGAGCATGAGCCGCGCG
AACACCTGGTGAGTCTGCCGCTGCTGCGCCTGCGACGGCAGGCGGCCGGCGGCTTCGAGTACGACGGTCG
CTTCATGCCGCCGTGCGTGGCGCTGCAGGCATCGCCCATGCTGGTGTCGATGCTGCGGCGGCTCATCGAG
ATGCTGCAGGCCAAGGTCGATGCGCTGTACGGCTTTCACCGCGAGCCGTCCAAGCACGTGATCGAGTTCC
GCTCGGGCGACGTCGCTTCGTTCTGGCTGCTGCATACCGCCAGCTCGGCCTGCGCGGCGCTCACGCACTA
CCAGCACAACCCGGCCCTGCACCCCGAGCGCCTGTTCGAGCGCCTGCTTGAGCTGGCAGGGGCGCTGATG
ACCTTCTCCAAGAGCTTCACGCTCGCCGATCTGCCGCCGTACCGCCACGATGCGCCCGGGCCGGCCTTCC
TGAAGCTCGACACCATCGTGCGTGAACTGCTGGAGACCGTGATCTCCACGCGCTACTTCGCGATTGCACT
GGCCGAGGTGCGGCCGTCATTCCACGTCGGCCGGCTCGACAGCGAGCAGATCACGCTTTCCACCACGCTG
GTGCTCGGCGTCAGCGCCGCAATGCCGGCTGCCGAGTTGGTCGACGCGGTGCCGCTGCGCCTGAAAGTCG
GCGGCCCCGACGACGTCGCAAAGCTCGTGCTGTCGGCAATGGCCGGCGTGCGGCTGGTTCATATGCCTCA
GGTCCCGGCCGCCATCCCGGTGCGCCCTGGCAGCTACTACTTCCAGTTCGAGGCGCGCGGGCCGCTCTAT
GAACGCATGTTGCAGAGCCAGTCGGTCACGATCTACGTGCCGTCGGGCATCGAGGAAGTGCGGCTCGAAC
TCTTCGCCCTCAACGCATAA