SecReT6
Protein ID: 383758433
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25800
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2716150..2716947 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDI0HSD2
KEGG IDrge:RGE_25800
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-55, Aligned region: 29..236
Protein Sequence: 265 a.a.     [Download]
>gi|383758433|ref|YP_005437418.1| DotU family type IV / VI secretion system protein [Rubrivivax gelatinosus IL144]
MADTPAAPSLMPGLRPTPRAGGSTHEARSLLDLMVDGFYMLFLLKNRYVPSGADEFRERIRDFLDGVERG
AKKLGQAGVETPAEDIYLAKYAYCALVDEIVLSSQGSMRDTWARKPLQLELFGEQLAGENFFVRLEELRR
QGAARVQALEVFHMCLLMGFQGRYMLEQGSEKLGYLCDRLGDEIANLKGRRAPFAPHWQAPDSVMNRLRG
EVPLWVVGALFALAGLAAFIGMRWSLERETKGDLAGYAQIVKLPPPTAHITITLP
 
Nucleotide Sequence: 798 bp     [Download]
>gi|383755859|ref|NC_017075.1|:2716150-2716947 Rubrivivax gelatinosus IL144, complete genome
ATGGCCGACACCCCTGCCGCTCCTTCGCTGATGCCCGGCTTGCGGCCAACCCCCAGAGCGGGCGGCAGCA
CGCACGAGGCCCGCTCGCTGCTCGACCTGATGGTCGACGGGTTCTACATGCTCTTTCTTCTGAAGAACCG
CTATGTGCCCAGCGGTGCCGACGAGTTCCGCGAGCGCATCCGCGATTTTCTCGACGGCGTCGAGCGCGGT
GCCAAGAAGCTGGGGCAGGCCGGCGTCGAGACGCCGGCCGAGGACATCTACCTTGCCAAATACGCCTATT
GCGCGCTGGTCGACGAGATCGTGTTGAGCTCGCAGGGGTCGATGCGAGACACCTGGGCGCGCAAACCGCT
GCAGCTGGAGCTGTTCGGCGAGCAACTGGCCGGCGAGAACTTCTTCGTCCGCCTGGAGGAGCTGCGCCGC
CAAGGTGCGGCCCGAGTGCAGGCCCTCGAGGTCTTTCACATGTGCCTGCTGATGGGCTTCCAGGGCAGGT
ACATGCTGGAGCAAGGGTCCGAGAAGCTGGGTTATCTGTGCGACCGCCTGGGCGACGAGATTGCCAACCT
CAAGGGCCGGCGGGCGCCATTCGCGCCGCACTGGCAGGCGCCCGATTCGGTGATGAACCGTCTGCGAGGT
GAAGTACCGCTGTGGGTCGTCGGAGCGCTATTCGCACTAGCGGGGCTGGCGGCTTTCATCGGCATGCGCT
GGTCGCTGGAACGCGAGACGAAGGGCGACCTGGCGGGCTACGCGCAGATCGTCAAGCTCCCGCCCCCCAC
GGCCCACATCACCATTACGCTGCCGTAG