SecReT6
Protein ID: 383758434
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25810
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2716979..2719774 [+]
Producthypothetical protein
NoteTssI
UniProt IDI0HSD3
KEGG IDrge:RGE_25810
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-63, Aligned region: 44..372
Phage_GPD [PF05954], Evalue: 1.20E-63, Aligned region: 737..792
DUF2345 [PF10106], Evalue: 1.80E-39, Aligned region: 592..632
DUF2345 [PF10106], Evalue: 1.80E-39, Aligned region: 689..842
T6SS_Vgr [PF13296], Evalue: 1.70E-26, Aligned region: 529..643
Phage_base_V [PF04717], Evalue: 2.70E-20, Aligned region: 416..510
Protein Sequence: 931 a.a.     [Download]
>gi|383758434|ref|YP_005437419.1| hypothetical protein RGE_25810 [Rubrivivax gelatinosus IL144]
MSSKQRASRLDFTALLDQQGRMLQLESALPALALVPERMVLQDAVSQPFELVLDAIGSSAFFELKTLVGE
QLSVRLLQPDGRGKPFHGYVFEAAQLGSDGGLARYRLVMRPWLSFLALRRDAFVFQDKTAQQIVEEVFCH
YPSANFRFELSDELRQRSLCVQYRETDLQFVQRLLAEEGLSWHFEHLDDGASDAHAEGHAKHVLVVTDRM
ATRPALGDARFTSQHPTASVRGQKDAVTAFMAQRQLMPNAVTLGSWDYKHLCGTAAEDSTALAIGELPVL
EVYDGAGAYHHADSDRAARAAALALAALELDFERFEGQGSTRHFDAGRTFRLVDHPLFGANTTALNYAGA
LLHETADNEFVLLAVEHHATNNLGAQVAELLGGTELEHGSYKNHFHAARASTPVVPRFIRKPSAHGLQTA
LVVGVQGEPVTTDRDLRVKIQFPWQRGGNAPGNETSGTWVRVAQSAAGANWGQVFVPRIGSEVAVAFVEG
DIDRPVVTGGLYNGQDLPPFSAGVDSGINHPGVIDGWHSQALDGAGFNQWALDNSTGQLRLRLHASYGAG
ELGLGHLIQQPGESAQRGAWRGAGFEAGTQGWASLRAGKGLLLSTSARPGSYGSAQGTQMDAAEAVTQLK
AARDLGARLSGAARSGMAAPLPTHDEGQALARFVQAIDPQQDGRHAGPVNGQQAQKADGRTPGEPVETFA
QPNVLLDTPSTLLMASEASIAAFAGQDFSAVVQGDIQHTAAHTYAGVSGQTTSWYTHQGGAKLHAANGPV
SIQAHTDALQILADREVTVISVNDEITVSAKSRIELVAGQSAIVLDGANIDFSCPGKWQVKASSHGFQGG
ASQAASLPALPDGRATLFQEQFVARNAISGRPVAGMPYRIELSDGEVITGVTDEYGKTEVLATADPQGVK
LYWVPAVDGGISSDEPDTEIC
 
Nucleotide Sequence: 2796 bp     [Download]
>gi|383755859|ref|NC_017075.1|:2716979-2719774 Rubrivivax gelatinosus IL144, complete genome
ATGTCATCGAAGCAGCGGGCGAGCCGCCTGGACTTCACGGCCCTGCTGGATCAGCAGGGCCGCATGCTGC
AACTGGAAAGCGCGCTGCCCGCGCTGGCACTCGTGCCCGAACGCATGGTGCTCCAGGACGCGGTCAGCCA
ACCCTTCGAGCTGGTGCTCGACGCCATCGGTTCGAGTGCGTTCTTCGAGCTGAAGACCTTGGTGGGCGAG
CAGCTCAGCGTGCGCCTGCTGCAGCCCGACGGCCGTGGCAAACCGTTCCACGGTTATGTGTTCGAAGCCG
CGCAGCTGGGCAGCGACGGCGGTCTCGCGCGCTACCGGCTGGTGATGCGGCCTTGGCTGTCTTTTCTTGC
GCTGCGGCGCGATGCATTCGTCTTCCAGGACAAGACCGCGCAGCAGATCGTCGAAGAGGTTTTCTGTCAC
TACCCGAGCGCGAACTTCCGCTTCGAGCTGAGCGATGAGCTGCGCCAGCGCAGCCTGTGCGTGCAGTACC
GCGAGACCGATCTCCAGTTTGTGCAGCGGCTGCTGGCCGAAGAGGGCCTGAGCTGGCATTTCGAGCACCT
GGACGACGGCGCATCCGATGCCCACGCGGAGGGGCATGCGAAACACGTGCTCGTCGTCACCGACCGCATG
GCCACGCGGCCGGCGCTGGGCGACGCGCGTTTCACCAGCCAGCATCCCACGGCCAGCGTGCGCGGCCAGA
AGGACGCCGTGACGGCCTTCATGGCGCAACGCCAGCTGATGCCCAACGCGGTGACGCTGGGCAGCTGGGA
CTACAAGCACTTGTGTGGCACGGCGGCCGAGGACAGCACGGCGCTGGCCATCGGCGAACTGCCCGTGCTG
GAGGTCTATGACGGTGCCGGCGCCTACCACCATGCCGACAGCGACCGAGCTGCACGCGCCGCAGCGCTTG
CACTGGCCGCGCTGGAACTGGACTTCGAGCGGTTCGAAGGGCAGGGCAGCACGCGCCACTTCGATGCCGG
GCGCACGTTCAGGCTCGTCGACCATCCGCTGTTCGGCGCCAACACCACGGCGCTGAACTACGCCGGTGCG
CTGCTGCACGAAACGGCCGACAACGAGTTCGTCCTGCTGGCCGTGGAACACCACGCGACCAACAACCTTG
GCGCGCAGGTGGCCGAGTTGCTAGGCGGCACAGAACTGGAGCACGGCAGCTACAAGAACCACTTCCACGC
CGCGCGCGCGTCGACACCGGTGGTGCCGCGCTTCATCCGCAAACCCAGCGCACACGGCCTGCAGACGGCC
TTGGTCGTGGGCGTGCAGGGCGAGCCCGTCACCACCGACCGCGACCTGCGGGTGAAGATCCAGTTCCCCT
GGCAGCGTGGCGGCAACGCACCGGGAAACGAGACCTCGGGCACCTGGGTGCGTGTGGCCCAGAGCGCCGC
CGGCGCCAACTGGGGCCAAGTTTTCGTGCCGCGCATCGGCTCCGAGGTTGCGGTGGCCTTCGTCGAAGGC
GACATCGACCGCCCGGTGGTCACCGGCGGGCTCTACAACGGCCAGGATCTGCCGCCGTTCTCCGCCGGCG
TGGACTCGGGCATCAACCACCCCGGCGTGATCGACGGCTGGCACAGCCAGGCGCTGGACGGTGCTGGCTT
CAACCAATGGGCGCTGGACAACAGCACCGGCCAGTTGCGCCTGCGCCTGCACGCCAGCTACGGTGCCGGC
GAGCTGGGTCTGGGCCACCTCATCCAGCAGCCCGGGGAAAGCGCGCAGCGCGGCGCCTGGCGCGGCGCGG
GTTTCGAGGCCGGCACGCAAGGCTGGGCGTCGCTGCGCGCGGGCAAAGGGCTGCTGTTATCGACCTCGGC
GCGGCCCGGCAGCTACGGCTCGGCACAGGGCACGCAGATGGACGCAGCCGAGGCCGTGACGCAGCTGAAG
GCCGCACGCGACCTGGGTGCCCGGCTTTCGGGCGCAGCGCGTTCAGGCATGGCCGCGCCGCTACCCACGC
ACGACGAGGGCCAGGCGCTGGCGCGTTTCGTCCAGGCGATCGATCCGCAGCAAGACGGCCGGCACGCCGG
GCCCGTCAACGGCCAGCAGGCGCAGAAGGCGGACGGCCGCACTCCGGGCGAGCCGGTGGAGACCTTCGCC
CAGCCAAACGTGCTGCTGGACACCCCGAGCACGCTGCTAATGGCAAGCGAGGCGAGCATCGCGGCCTTTG
CCGGGCAGGACTTCAGCGCCGTGGTCCAGGGCGACATCCAGCATACGGCGGCGCACACCTACGCCGGCGT
CTCGGGGCAGACGACGAGCTGGTACACGCACCAGGGCGGCGCCAAGCTGCACGCGGCCAACGGCCCGGTG
TCGATCCAGGCCCACACCGACGCTCTGCAGATCCTGGCCGACCGCGAGGTGACGGTCATCTCGGTCAACG
ACGAGATCACCGTCAGCGCGAAGAGCCGCATCGAGCTCGTGGCCGGCCAGAGCGCCATCGTGCTCGACGG
CGCCAACATCGACTTCTCGTGCCCGGGCAAATGGCAGGTCAAGGCCTCCAGCCATGGGTTCCAGGGTGGC
GCAAGCCAGGCGGCGAGCTTGCCGGCCTTGCCGGACGGCCGGGCGACACTGTTCCAGGAGCAGTTCGTGG
CAAGAAATGCGATCAGCGGCCGGCCCGTGGCCGGCATGCCCTACCGCATCGAGCTCAGCGACGGCGAGGT
CATCACCGGCGTGACCGACGAGTACGGCAAGACGGAGGTGCTCGCCACGGCCGATCCGCAGGGGGTCAAG
CTCTACTGGGTGCCCGCCGTGGACGGCGGCATCTCGAGCGATGAGCCCGACACAGAGATTTGCTGA