SecReT6
Protein ID: 383758439
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25860
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2723607..2724653 [+]
Producthypothetical protein
NoteTssA
UniProt IDI0HSD8
KEGG IDrge:RGE_25860
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.00E-25, Aligned region: 53..114
Protein Sequence: 348 a.a.     [Download]
>gi|383758439|ref|YP_005437424.1| hypothetical protein RGE_25860 [Rubrivivax gelatinosus IL144]
MSVENLLSPLAGDAPTGANLSFSRDFDAIAEMRRADDPTLSQGEWVSELKTADWPGVASTCENLLAQRTK
DLRVVGWLAEAWAQLRGYAGLADGIALAQGLCERYWASLHPLPEGEDFDLRRGALAHLLTQVVQLGSALP
VLRRGDVAYSLLDMDAARALGAVLATARDPGAVPTAGKVTPEDIAKALRETPASALVEHLEHGRRAREAL
LALQSVVDGHLGADGPAFGAARSALDEAVHALERLVRGVSPPATATPLAAASPEAPVAEPLPAPNFGAQP
TTRAQALAQLRLVAEYFRTHEPHSPVAYLAERAAHWGELPLHEWLRLVMKDGGSLAQLEELLGVETRN
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|383755859|ref|NC_017075.1|:2723607-2724653 Rubrivivax gelatinosus IL144, complete genome
ATGTCCGTTGAGAACCTGCTTTCACCGCTGGCCGGCGATGCCCCCACCGGCGCCAACCTGAGCTTCTCCC
GCGACTTCGATGCCATCGCCGAAATGCGCCGCGCTGACGACCCGACGCTGTCGCAAGGCGAATGGGTCAG
CGAGCTCAAGACCGCAGACTGGCCCGGAGTCGCGTCCACCTGTGAAAACCTGCTGGCCCAGCGCACGAAG
GATCTGCGCGTCGTCGGCTGGCTGGCCGAGGCCTGGGCTCAGCTGCGCGGCTACGCCGGCCTGGCCGACG
GAATCGCGCTGGCGCAGGGCTTGTGCGAGCGCTACTGGGCCAGCCTGCATCCGCTGCCCGAAGGCGAAGA
CTTCGACCTGCGCCGCGGTGCGTTGGCGCACCTGCTCACGCAGGTGGTGCAGCTGGGATCCGCGCTGCCG
GTGCTGCGGCGCGGCGACGTGGCCTACTCGCTGCTCGACATGGACGCGGCACGCGCGCTGGGGGCGGTGC
TCGCCACGGCGCGCGATCCGGGCGCCGTGCCCACAGCCGGTAAGGTGACCCCCGAGGACATCGCCAAAGC
GCTGCGCGAGACACCTGCCTCGGCGCTTGTCGAGCACCTGGAACACGGCCGCCGCGCCCGCGAAGCGCTG
CTGGCGCTGCAGTCCGTGGTCGACGGCCACCTGGGCGCCGACGGGCCGGCTTTCGGCGCCGCCCGAAGCG
CGCTCGACGAGGCCGTGCATGCGCTGGAGCGTCTGGTGCGAGGCGTGAGCCCGCCCGCCACCGCAACGCC
CTTGGCAGCAGCTTCACCGGAGGCTCCCGTGGCCGAACCCTTGCCGGCGCCCAACTTCGGCGCGCAACCC
ACGACCCGTGCCCAGGCACTGGCTCAGCTGCGGCTGGTGGCCGAGTACTTCCGCACCCACGAACCCCACA
GTCCCGTGGCCTACCTGGCCGAACGCGCAGCGCACTGGGGCGAACTGCCGCTGCACGAGTGGCTGCGCCT
CGTCATGAAGGACGGCGGCTCGCTCGCACAACTCGAAGAGCTTCTGGGCGTGGAAACCAGGAACTGA