SecReT6
Protein ID: 383758447
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25940
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2733898..2736903 [+]
Producthypothetical protein
NoteTssI
UniProt IDI0HSE6
KEGG IDrge:RGE_25940
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-56, Aligned region: 36..375
DUF2345 [PF10106], Evalue: 6.50E-43, Aligned region: 766..929
T6SS_Vgr [PF13296], Evalue: 5.50E-36, Aligned region: 69..94
T6SS_Vgr [PF13296], Evalue: 5.50E-36, Aligned region: 602..709
T6SS_Vgr [PF13296], Evalue: 5.50E-36, Aligned region: 778..816
Phage_base_V [PF04717], Evalue: 3.40E-23, Aligned region: 438..537
Protein Sequence: 1001 a.a.     [Download]
>gi|383758447|ref|YP_005437432.1| hypothetical protein RGE_25940 [Rubrivivax gelatinosus IL144]
MNLFDPAAWFDSSRRLYELKGEGPLVGLQVEAWGQREALSDPGELHISCLAQRADLDIEDMLGRRVDLLT
TQADGARGVRGGLVMAAHALDGDGGFARYALEVRPWIALLAHTRRSQVWQERSLRQIVDAVFRDYAAYAA
WRWAADVDAHLAASAFTGTDGVRSYCVQYRETDLAFVQRLLAEEGLAWRIEPDDAAPLGHALVIFADSAQ
AESCPEDTVSAASGGVRFHREAAVEEQDSIQAFGGLRTLQSTTVSTVAWDYKAHRSVVASVPTAFAFGGG
SSGALADLLESYQPAGAYAFADTSRAERAALLLQQTLEARHKRWLGRGTVRSFRPGCTFALLDSPLDLLP
ELGASHSERDRQFLLTQVVHAGINNLPKDTSEYVAQALPDWVPAPVRAQAAASGYGNAFEALRANVPWRP
WRWDDSGALLNPRPQAPGLQTATVVGPEGDAASAEEIHTDRQGRVRVRFPWQDGEHRAADTSRSSTWVRV
IQRWAGAGHGVQWIPRIGQEVLVGFVEGDIDRPLVQGALYNGRGEAGVPATPGGAQALADRAPLSASSDH
APGAQGNLTSGHSPAWHGAGPGEAAEGQNTQNNAAALSGFKTREFGGVGFNQLVFDDSDSQLRVQLATTQ
HATQLNLGHLVHQADNHRGSFRGLGFELRTDAWGAIRAARGILLTTYGQPEAAPAGDNAAGLALAKQLAT
LIKTFSDAARTHQTTQLAAHIGSFEAGKAAISDSEAPAHAMLTSLKGMVADTSLDEALGDAAARSTRTAE
GKLPHMADPMVAISAKAGLGLVAGQDLQMAAGETLTLAAGQNLEQASGGALRIHTGQSIGVLAGAVKPGE
ETAGKGITLIAGQGDISVQAQSDTLRVAAKQDVSVQSASAHVDWAAAKKITLATAGGARLTLEGGNIVFE
CPGKLSVWAGKKSFAGPQQTRYAMPELPPGAGFMRRYVIRRRSDARPIAHQKYRMTLDDGRVFEGVTDAQ
GQTSLAQSDGMQHVRIELLFD
 
Nucleotide Sequence: 3006 bp     [Download]
>gi|383755859|ref|NC_017075.1|:2733898-2736903 Rubrivivax gelatinosus IL144, complete genome
ATGAACCTGTTCGACCCCGCGGCGTGGTTCGACTCCAGCCGCCGGCTGTACGAGTTGAAAGGGGAGGGCC
CTCTGGTCGGTCTTCAGGTGGAAGCCTGGGGCCAGCGCGAAGCGCTCAGCGATCCCGGCGAACTGCACAT
CAGCTGCCTTGCCCAGCGTGCCGATCTCGACATCGAGGACATGCTCGGCCGGCGCGTGGACCTGCTCACC
ACGCAAGCCGACGGTGCCCGCGGCGTGCGCGGCGGTCTGGTGATGGCGGCCCATGCGCTGGACGGTGACG
GCGGCTTCGCGCGCTACGCGCTGGAAGTGCGGCCCTGGATCGCGCTGCTGGCCCACACCCGGCGCAGCCA
GGTGTGGCAGGAACGCAGCCTGCGCCAGATCGTCGACGCGGTGTTCCGCGACTACGCGGCCTACGCCGCC
TGGCGCTGGGCTGCGGATGTCGACGCCCACCTGGCTGCCAGCGCCTTCACCGGCACCGACGGCGTGCGCA
GCTACTGCGTGCAGTACCGCGAGACGGACCTGGCGTTCGTGCAGCGCCTGCTGGCCGAAGAAGGCCTGGC
CTGGCGCATCGAGCCCGACGACGCGGCGCCGCTGGGCCATGCGCTGGTCATCTTCGCCGACAGCGCGCAG
GCCGAGTCTTGCCCCGAGGACACGGTCTCGGCCGCTTCAGGCGGCGTGCGCTTTCACCGCGAAGCCGCGG
TCGAGGAACAGGACAGCATCCAGGCCTTCGGCGGGTTGCGAACGCTGCAGTCCACCACTGTCTCAACGGT
GGCCTGGGACTACAAGGCCCACCGCAGCGTCGTGGCCAGCGTGCCCACCGCCTTCGCGTTCGGTGGCGGC
TCCTCAGGCGCACTGGCGGACCTGCTGGAGAGCTACCAGCCCGCCGGCGCCTATGCCTTTGCCGACACCT
CCCGTGCCGAGCGCGCCGCACTGCTGCTGCAGCAGACGCTCGAAGCTCGCCACAAGCGCTGGCTGGGCCG
CGGCACCGTGCGCAGCTTCAGGCCCGGGTGCACCTTTGCGCTGCTCGATAGCCCGCTGGACCTGCTGCCT
GAGCTGGGGGCCAGCCACAGCGAGCGTGACCGCCAGTTCCTGCTGACCCAGGTCGTGCACGCCGGCATCA
ACAACCTGCCCAAGGACACGAGCGAGTACGTCGCCCAGGCGCTACCCGACTGGGTGCCCGCCCCCGTGCG
CGCCCAGGCCGCCGCCAGCGGCTACGGCAACGCCTTCGAAGCCCTGCGCGCCAACGTGCCCTGGCGGCCC
TGGCGCTGGGACGACAGCGGCGCGCTGCTCAACCCGCGCCCGCAGGCGCCGGGCCTGCAGACGGCCACCG
TCGTCGGCCCCGAGGGCGATGCCGCCTCGGCCGAAGAGATCCACACCGACCGCCAGGGCCGTGTGCGCGT
GCGTTTTCCTTGGCAGGACGGCGAGCACCGCGCGGCCGACACGAGCCGCTCGTCCACCTGGGTGCGCGTC
ATCCAGCGCTGGGCCGGCGCCGGCCACGGCGTGCAGTGGATCCCGCGCATCGGCCAGGAAGTGCTGGTGG
GCTTCGTCGAAGGCGACATCGACCGGCCCCTGGTGCAAGGCGCGCTGTACAACGGCCGCGGCGAGGCCGG
CGTGCCGGCCACGCCGGGCGGAGCACAGGCCCTGGCCGATCGGGCGCCGCTGTCCGCCAGCAGCGACCAC
GCGCCTGGCGCGCAGGGCAACCTCACGTCGGGCCACAGCCCGGCCTGGCACGGCGCCGGCCCGGGCGAAG
CCGCCGAAGGCCAGAACACGCAGAACAACGCCGCGGCGCTGTCGGGCTTCAAGACGCGCGAGTTCGGCGG
CGTCGGCTTCAACCAGCTTGTCTTCGACGACAGCGACTCGCAGCTGCGGGTGCAGCTGGCGACCACGCAG
CACGCCACGCAGCTCAACCTTGGGCACCTCGTCCACCAGGCCGACAACCACCGCGGCAGCTTTCGCGGTC
TGGGCTTCGAGCTGCGCACCGACGCCTGGGGCGCGATCCGCGCGGCCCGGGGCATCCTGCTGACCACCTA
TGGCCAGCCCGAGGCCGCGCCGGCCGGCGACAACGCTGCCGGGCTGGCGCTGGCCAAGCAACTGGCCACG
CTGATCAAGACCTTCAGCGACGCGGCCAGGACGCACCAGACCACGCAGCTGGCCGCCCACATCGGCAGCT
TCGAAGCCGGCAAGGCGGCCATCAGCGACAGCGAGGCCCCGGCCCACGCGATGCTCACCAGCCTGAAGGG
CATGGTGGCCGACACCAGCCTGGACGAAGCCCTGGGCGATGCCGCGGCCAGGAGCACCCGCACCGCCGAA
GGCAAGCTGCCGCACATGGCCGACCCGATGGTGGCAATCAGCGCCAAGGCGGGCCTGGGCCTTGTCGCCG
GGCAAGACCTGCAGATGGCCGCCGGCGAGACCCTCACGCTGGCGGCGGGGCAGAACCTGGAGCAGGCCAG
CGGCGGCGCGCTGCGCATCCACACCGGCCAGAGCATCGGCGTGCTGGCCGGAGCGGTGAAACCGGGTGAA
GAGACCGCCGGCAAAGGCATCACCTTGATCGCCGGCCAGGGCGACATCAGCGTGCAGGCGCAGAGCGACA
CGCTGCGCGTGGCGGCCAAGCAGGACGTGAGCGTCCAGAGCGCCAGTGCGCATGTGGACTGGGCCGCGGC
CAAGAAGATCACCCTGGCCACCGCCGGCGGCGCCCGGCTCACGCTGGAGGGCGGCAACATCGTCTTCGAG
TGCCCGGGCAAGCTCTCGGTGTGGGCGGGCAAGAAGAGTTTTGCGGGGCCGCAGCAGACCCGCTACGCGA
TGCCTGAGCTTCCCCCCGGTGCCGGCTTCATGCGCCGGTACGTCATCCGGCGGCGGTCCGATGCGCGACC
CATTGCACACCAGAAGTACCGCATGACGCTCGATGATGGCCGGGTCTTCGAAGGCGTCACCGACGCCCAG
GGCCAGACCAGCCTGGCGCAAAGCGACGGCATGCAGCACGTGCGCATCGAACTCCTCTTCGACTGA