SecReT6
Protein ID: 383758882
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30290
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3216399..3219158 [-]
Producthypothetical protein
NoteTssI
UniProt IDI0HTN1
KEGG IDrge:RGE_30290
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-47, Aligned region: 38..349
Phage_GPD [PF05954], Evalue: 4.80E-47, Aligned region: 669..687
DUF2345 [PF10106], Evalue: 4.30E-24, Aligned region: 571..590
DUF2345 [PF10106], Evalue: 4.30E-24, Aligned region: 676..821
Phage_base_V [PF04717], Evalue: 2.70E-21, Aligned region: 394..503
T6SS_Vgr [PF13296], Evalue: 1.20E-20, Aligned region: 38..47
T6SS_Vgr [PF13296], Evalue: 1.20E-20, Aligned region: 522..625
T6SS_Vgr [PF13296], Evalue: 1.20E-20, Aligned region: 746..764
Protein Sequence: 919 a.a.     [Download]
>gi|383758882|ref|YP_005437867.1| hypothetical protein RGE_30290 [Rubrivivax gelatinosus IL144]
MSPGEGLVGGWSLQGRLLRVQTPPGQVPLLARRLEADEAVGRGFELQLEVLAEPGADVDALLGEELGVHL
QRADGSERAWYGLVVESRWAGAAAGGERWTLRLGPWSTLLEQRVGCALHEDASVAAILEQVFAGLPQAHW
VLALTRELPRRPLCTQYAETDWAFCIRLMAEEGLAWHFEALQGEAAEAAAASGRWRHRLVVADEGTARAE
LGPLRFAADPPTATAGARHDSVDRLAEHHGGGPARVLLGSWCSRSGGSLAAASESDLGAGPRPEHHERRG
VDRFADRSAAGVQAERLLRAFELGRQRVRGEGNARDLAAGTVVVVQGLPGDEAGGRRFTVLAVHHEAANA
LEPDRAHAPGAAEPAAGRYRNRFEAVPAERALVTRRPPRPTAPGWQTATVVGVEHGLPMADGALRVKLRY
AWQGDADPGGDGLAQTPWPLRRAAGRRGSAWVRVAQSLAGAGWGSVFVPRVGAEVLVGFVDGELDRPVVL
GALFNGRDPPPYAGAPLAGIVSACQPPTRGCAGEWVLDDTTGQLRTRLASLPMAAELGLGWLVAQPAGSA
GRGGLRGVGFEAVTAGTASLRAGQGLLLTTHARAAHGGSCDGEQMDVQEVHRRLESARATVAALRPAGEG
WPSALADGPARAAQALPPPAGPAAAATRADGLDSSTSATSSTSTEGHAPETAWLVLAAEATLAVASDGER
VHTAARDVAAVAGGAWHAAAGQDAAFVAGGAVRLASTGAGVAFVAGHGEAALRAHAGGLALHADGPLQVS
AQGGELRLVARHRLVLRAAGSEIVLDGADLRLTTPGVLTVAAAAHRFPGPGRVPAPRPALPQGRPGAPPN
WIEIEHHDAEGRPFAGQRYRIRFEGGSTIEGRLDAQGHARHEQVPERAEGVDYEAREPLPAPPWPPLAEL
VDALRERLG
 
Nucleotide Sequence: 2760 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c3219158-3216399 Rubrivivax gelatinosus IL144, complete genome
ATGAGCCCGGGCGAGGGCCTCGTCGGCGGCTGGTCGCTGCAGGGGCGTCTGCTGCGGGTGCAGACGCCGC
CGGGGCAGGTGCCGCTGCTGGCCCGACGGCTGGAGGCCGACGAGGCCGTGGGCCGCGGCTTCGAGCTGCA
GCTGGAGGTGCTGGCCGAACCCGGCGCCGACGTCGACGCGCTGCTCGGCGAGGAACTCGGCGTGCACCTG
CAGCGCGCCGACGGTTCCGAGCGTGCCTGGTACGGCCTGGTCGTCGAGAGCCGCTGGGCCGGCGCGGCGG
CCGGCGGCGAGCGCTGGACGCTGAGACTGGGCCCCTGGAGCACGCTGCTGGAGCAGCGCGTCGGCTGTGC
GCTGCACGAGGACGCCAGCGTCGCCGCGATCCTCGAGCAGGTGTTCGCCGGCCTGCCGCAAGCGCATTGG
GTGCTGGCGCTGACGCGCGAGCTGCCGCGGCGGCCGCTGTGCACCCAGTACGCCGAGACCGACTGGGCCT
TCTGCATCCGGCTGATGGCCGAGGAAGGCCTGGCCTGGCACTTCGAGGCGCTGCAAGGCGAGGCCGCCGA
GGCTGCCGCGGCCTCGGGCCGCTGGCGCCACCGCCTCGTCGTCGCCGACGAGGGCACGGCTCGCGCCGAA
CTCGGCCCGCTGCGCTTTGCTGCCGATCCGCCCACCGCCACTGCCGGCGCGCGGCACGACAGCGTCGATC
GCCTGGCCGAACACCACGGCGGCGGCCCTGCCCGTGTGCTGCTCGGAAGCTGGTGCAGCCGCAGCGGTGG
GTCGCTGGCCGCTGCCAGCGAGTCCGATCTTGGCGCCGGGCCGCGGCCCGAGCACCACGAACGGCGTGGC
GTCGACCGCTTCGCCGACCGCAGCGCCGCCGGCGTGCAGGCCGAGCGCCTGCTGCGGGCCTTCGAGCTCG
GGCGCCAACGCGTGCGCGGCGAAGGCAACGCCCGCGATCTGGCCGCCGGCACGGTGGTCGTGGTGCAAGG
CCTGCCCGGCGACGAGGCCGGCGGCCGACGTTTCACGGTGCTGGCGGTGCACCACGAGGCCGCCAACGCG
CTGGAGCCGGACCGGGCGCATGCCCCCGGGGCAGCCGAACCCGCCGCCGGCCGTTATCGCAACCGCTTCG
AGGCGGTGCCGGCCGAACGTGCGCTCGTCACGCGTCGGCCGCCGCGGCCGACGGCGCCCGGCTGGCAGAC
CGCCACCGTGGTCGGCGTCGAACACGGCCTGCCGATGGCCGACGGCGCGCTGCGCGTCAAGCTGCGCTAC
GCCTGGCAGGGCGATGCCGACCCCGGCGGCGACGGCCTTGCCCAGACCCCGTGGCCCTTGCGCCGCGCCG
CCGGGCGCCGCGGCAGCGCCTGGGTGCGGGTGGCGCAGTCGCTGGCTGGCGCCGGCTGGGGCAGCGTCTT
CGTGCCGCGTGTCGGTGCCGAGGTGCTGGTCGGTTTCGTCGACGGCGAGCTCGACCGGCCGGTGGTGCTG
GGGGCGCTGTTCAACGGCCGCGACCCGCCGCCGTACGCCGGTGCGCCGCTGGCCGGCATCGTCAGCGCCT
GCCAGCCGCCGACGCGCGGCTGCGCCGGCGAATGGGTGCTCGACGACACCACGGGCCAGTTGCGCACGCG
CCTGGCGAGCCTGCCGATGGCGGCCGAACTGGGCCTGGGCTGGCTGGTCGCGCAGCCGGCCGGCAGTGCC
GGCCGCGGCGGCCTGCGCGGCGTGGGTTTCGAGGCGGTCACTGCCGGCACCGCGTCGCTGCGCGCGGGCC
AGGGCCTGCTGCTGACGACGCACGCCCGGGCGGCCCACGGGGGCTCCTGCGACGGTGAGCAGATGGACGT
GCAGGAGGTGCACCGGCGGCTGGAGAGTGCCCGCGCGACGGTGGCGGCCTTGCGCCCGGCGGGGGAGGGC
TGGCCGTCAGCACTCGCCGACGGCCCGGCGCGGGCGGCCCAGGCGCTGCCACCGCCGGCCGGCCCGGCTG
CGGCCGCCACACGCGCCGACGGCCTCGACAGCAGCACCAGTGCCACCAGCTCCACCAGCACCGAAGGCCA
CGCCCCGGAAACCGCCTGGCTGGTGCTCGCCGCCGAGGCGACGCTGGCCGTGGCGAGCGACGGCGAACGG
GTGCACACCGCGGCGCGCGACGTGGCGGCCGTCGCCGGCGGGGCCTGGCACGCAGCGGCCGGCCAGGACG
CCGCCTTCGTCGCCGGTGGCGCGGTCCGCCTGGCCAGCACCGGCGCCGGTGTTGCGTTCGTCGCCGGCCA
CGGCGAGGCGGCGCTGCGCGCCCACGCCGGCGGTCTGGCGCTGCACGCCGACGGCCCGTTGCAGGTGTCG
GCCCAGGGCGGCGAGTTGCGCCTCGTCGCCCGCCACCGCCTCGTGCTGCGCGCCGCCGGTTCGGAGATCG
TGCTCGACGGTGCCGATCTGCGCCTCACGACGCCCGGCGTGCTGACGGTGGCCGCGGCAGCGCACCGCTT
CCCGGGGCCGGGGCGCGTGCCGGCGCCGCGCCCGGCGCTGCCACAGGGGCGGCCGGGGGCGCCGCCGAAC
TGGATCGAGATCGAGCACCACGACGCCGAGGGCCGGCCCTTCGCCGGCCAGCGCTACCGCATCCGCTTCG
AGGGCGGCAGCACGATCGAAGGCCGGCTCGACGCGCAAGGCCACGCCCGCCACGAGCAGGTGCCCGAACG
CGCCGAAGGCGTCGATTACGAGGCGCGCGAGCCGCTGCCGGCGCCGCCCTGGCCGCCGTTGGCCGAACTC
GTCGACGCGCTGCGCGAACGCCTGGGCTGA

Protein ID: 383758893
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30400
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3228519..3231086 [+]
Producthypothetical protein
NoteTssI
UniProt IDI0HTP2
KEGG IDrge:RGE_30400
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-56, Aligned region: 64..369
Phage_GPD [PF05954], Evalue: 1.90E-56, Aligned region: 646..668
T6SS_Vgr [PF13296], Evalue: 5.50E-27, Aligned region: 571..669
T6SS_Vgr [PF13296], Evalue: 5.50E-27, Aligned region: 772..793
T6SS_Vgr [PF13296], Evalue: 5.50E-27, Aligned region: 814..834
DUF2345 [PF10106], Evalue: 6.10E-16, Aligned region: 692..838
Phage_base_V [PF04717], Evalue: 2.00E-09, Aligned region: 261..300
Phage_base_V [PF04717], Evalue: 2.00E-09, Aligned region: 446..524
Protein Sequence: 855 a.a.     [Download]
>gi|383758893|ref|YP_005437878.1| hypothetical protein RGE_30400 [Rubrivivax gelatinosus IL144]
MTALSQHGRLARLQTALGADCLVVHEACVWEAVGPCPDAGLAAPARQLPWLPWAEDEVQPAVGFRIELVA
LADDRGLDLAGLHGTPARLDLQTAAGLRPWHGHVREAGWLGGDGGLARVRLLIEPWIAWLHDEQHAEVFH
EASVVEIVDRVLGRPRAGGDPAPAWRWALADAARLPRRGRCVQAHESDLGFVERLLLDEGLSHWFEHEAD
AEAPGGGRHRLVIADHAGAFAPGACVRYAPGGTGPQEDTLARWSREQRLGTGRLRWASRDDRRVDLRPVA
AGDEVWPGLEAVDVADGYAYPTREDGARRAAARLEALAYDAMRCRASGGWRDAAAGACFTLTGHPLHDGS
DAARDRFVVSAVRHELRNDVAAGPMPSGTPGTPGAAAGPGHRCELVARPAGLAPRCVPRDGQGRPELRLA
PEADAPGLGSALVVGDGAPVATDRDHRVLLRFHWEQARDDGAAPATGDAASTAGRWVRVATPVAGDGWGG
VNPPRAGQEALLGFVAARHDRPLVLGTLYCSAGHEDEADAFTATARPPWRPDAGTPSPGPALGGTLSGWR
TRELHGGGAAGGRGNQLVFDDSPGAERVELGSDEAATRLQLGHLREQQDGRPLAPRGAGLDLRSEAWGAL
RAGGGLLLSSHARPGSQHEGRQLDAAEALARLQAAQRMAAPDAPAGGGTTPALDALCARLEAAAKAPGWS
CPDLLLAAPEGVFVASAGDTMQACDGDSEAFAQRLQQLAGRHLGLVAGGELRLQAAGDGGGSVLPTLCLH
AADGPATVRAGAGATVQAHGDVRIASCEATLDVRGAQSIRLGAAGASLCIDGHGITLAAPGMVLIGGGPV
RMDAGRSVAADTPPT
 
Nucleotide Sequence: 2568 bp     [Download]
>gi|383755859|ref|NC_017075.1|:3228519-3231086 Rubrivivax gelatinosus IL144, complete genome
ATGACGGCGCTGTCGCAGCACGGCCGCCTGGCGCGGCTGCAGACGGCGCTCGGCGCCGACTGCCTCGTCG
TGCACGAGGCCTGCGTCTGGGAAGCCGTCGGCCCCTGCCCCGACGCCGGGCTCGCCGCCCCGGCGCGACA
GCTGCCCTGGCTGCCCTGGGCCGAGGACGAGGTCCAGCCGGCGGTGGGCTTTCGCATCGAGCTCGTCGCA
CTCGCCGACGACCGCGGGCTGGACCTGGCGGGCCTGCACGGCACGCCGGCGCGGCTGGACCTGCAGACCG
CCGCCGGCCTGCGGCCCTGGCACGGCCACGTGCGCGAAGCCGGCTGGCTGGGCGGCGACGGTGGTCTGGC
GCGCGTGCGGCTGCTGATCGAGCCCTGGATCGCCTGGCTGCACGACGAGCAGCATGCCGAGGTCTTCCAC
GAAGCAAGCGTCGTCGAGATCGTCGACCGGGTGCTGGGGCGCCCGCGCGCCGGCGGCGATCCGGCCCCTG
CCTGGCGCTGGGCGCTCGCCGACGCCGCGCGCCTGCCGCGCCGCGGCCGCTGCGTGCAGGCGCACGAGTC
GGACCTGGGCTTCGTCGAACGCCTGCTGCTCGACGAGGGCCTCAGCCACTGGTTCGAACACGAGGCAGAC
GCCGAGGCACCGGGCGGCGGACGCCACCGCCTCGTGATCGCCGACCACGCCGGCGCCTTCGCCCCGGGCG
CCTGCGTGCGCTACGCCCCGGGCGGCACCGGGCCGCAGGAAGACACGCTGGCCCGCTGGAGCCGCGAGCA
GCGCCTGGGCACCGGCCGGCTGCGCTGGGCCAGCCGCGACGACCGCCGCGTCGACCTGCGGCCGGTCGCC
GCCGGCGACGAGGTCTGGCCGGGGCTGGAGGCCGTCGACGTCGCCGACGGTTATGCCTACCCGACCCGCG
AAGACGGCGCCCGGCGTGCCGCGGCGCGGCTGGAGGCCCTGGCTTACGACGCCATGCGCTGCCGCGCCTC
GGGCGGCTGGCGCGACGCTGCCGCGGGGGCCTGCTTCACGCTGACGGGCCACCCGCTGCACGACGGCAGC
GATGCGGCACGCGACCGTTTCGTCGTCAGCGCAGTGCGCCACGAACTGCGCAACGACGTCGCCGCCGGGC
CGATGCCGTCGGGCACGCCGGGAACGCCGGGCGCGGCGGCCGGCCCCGGCCACCGCTGCGAACTGGTCGC
CCGCCCGGCCGGTCTGGCGCCGCGGTGCGTGCCGCGCGACGGCCAGGGACGGCCCGAGCTGCGGCTGGCG
CCCGAGGCCGACGCGCCGGGGCTGGGCAGCGCGCTCGTCGTCGGCGACGGCGCCCCGGTGGCGACCGACC
GCGACCACCGCGTGCTGCTGCGCTTCCATTGGGAACAGGCGCGCGACGACGGCGCGGCGCCGGCCACCGG
CGACGCTGCCTCGACCGCCGGCCGCTGGGTGCGGGTGGCGACGCCGGTGGCCGGCGACGGCTGGGGCGGC
GTGAACCCGCCGCGCGCCGGCCAGGAGGCGCTGCTCGGCTTCGTCGCCGCGCGTCACGACCGGCCGCTGG
TGCTGGGCACGCTCTACTGCAGCGCCGGCCACGAGGACGAGGCCGACGCGTTCACCGCCACGGCCAGGCC
GCCGTGGCGGCCGGACGCCGGGACGCCGTCGCCCGGGCCGGCGCTGGGCGGCACGCTGTCGGGCTGGCGC
ACACGCGAGCTGCACGGTGGCGGGGCCGCCGGCGGGCGCGGCAACCAGCTCGTCTTCGACGACAGCCCCG
GCGCCGAACGGGTCGAACTCGGCAGCGACGAAGCCGCCACGCGGCTGCAACTGGGCCATCTGCGCGAGCA
GCAGGACGGCCGGCCGCTGGCGCCGCGAGGTGCCGGGCTGGACCTGCGCAGCGAGGCCTGGGGCGCGCTT
CGTGCCGGCGGCGGGCTGCTGCTCAGCAGCCACGCACGCCCCGGCAGCCAGCACGAAGGCCGCCAGCTCG
ACGCCGCCGAGGCGCTGGCGCGGCTGCAGGCGGCACAGCGCATGGCCGCACCGGACGCACCGGCCGGCGG
CGGCACGACACCGGCGCTGGACGCGCTCTGCGCGCGGCTGGAGGCCGCCGCGAAGGCCCCGGGCTGGTCG
TGCCCCGACCTGCTGCTCGCCGCGCCGGAAGGGGTTTTCGTCGCCAGCGCGGGCGACACGATGCAGGCCT
GCGACGGCGACAGCGAGGCCTTCGCGCAGCGCCTGCAGCAACTGGCCGGCCGGCACCTGGGCCTGGTGGC
CGGCGGCGAGCTGCGCCTGCAGGCCGCCGGCGACGGCGGCGGCAGCGTGCTGCCCACGCTGTGCCTGCAC
GCGGCCGACGGGCCGGCCACGGTGCGGGCCGGCGCCGGGGCGACGGTCCAGGCTCATGGCGACGTGCGCA
TCGCCTCCTGCGAAGCCACGCTGGACGTGCGCGGCGCGCAGAGCATCCGCCTCGGCGCCGCCGGCGCCTC
GTTGTGCATCGATGGCCACGGCATCACGCTGGCCGCGCCCGGCATGGTGCTGATCGGCGGCGGGCCGGTG
CGGATGGACGCCGGCCGCAGCGTGGCGGCCGACACGCCGCCGACATGA