SecReT6
Protein ID: 383758883
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30300
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3219155..3219895 [-]
Producthypothetical protein
NoteTssL
UniProt IDI0HTN2
KEGG IDrge:RGE_30300
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-47, Aligned region: 17..217
Protein Sequence: 246 a.a.     [Download]
>gi|383758883|ref|YP_005437868.1| hypothetical protein RGE_30300 [Rubrivivax gelatinosus IL144]
MDAAVAPPNDSTARADLLGLLHEGFYALMLVRAGARPDDVRAFRRALRDWLGGVEAEARRRGLDADDARL
ACFAFAALCDELALGAPGLLREAWLQQPLQHELFDEPLAGERFFEHLDRLREQGPRRLAVLEVFRLCLLL
GYQGRYAFQAPESRAWLVQRLDDEITRWRGGRAPFAPRAQPPDHLVHRLRRQVPAWAVVAVCAGVVLLAW
AALRLQLDRWTEQELARLPPAVQPLAEPARLSIRWP
 
Nucleotide Sequence: 741 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c3219895-3219155 Rubrivivax gelatinosus IL144, complete genome
ATGGACGCCGCCGTCGCCCCCCCGAACGACTCCACCGCCCGGGCCGACCTGCTCGGCCTGCTGCACGAAG
GTTTCTATGCCCTGATGCTGGTGCGCGCCGGGGCACGGCCCGACGACGTGCGTGCCTTCCGCCGGGCGCT
GCGCGACTGGCTGGGCGGTGTCGAGGCCGAAGCCCGCCGCCGGGGCCTGGACGCCGACGACGCCCGCCTG
GCCTGCTTCGCCTTCGCCGCGCTGTGCGACGAGCTGGCGCTCGGTGCGCCGGGGCTGCTGCGCGAGGCCT
GGCTCCAGCAGCCGCTGCAGCACGAGCTGTTCGACGAGCCGCTGGCCGGCGAACGTTTCTTCGAGCACCT
GGACCGGCTGCGCGAGCAGGGCCCGCGGCGGCTCGCGGTGCTGGAGGTCTTCCGCCTGTGCCTGCTGCTG
GGCTACCAGGGCCGCTACGCCTTCCAGGCGCCCGAGTCGCGTGCCTGGCTGGTGCAGCGCCTGGACGACG
AGATCACGCGCTGGCGCGGCGGCCGGGCCCCGTTCGCGCCGCGTGCCCAGCCGCCGGACCATCTGGTGCA
CCGTCTGCGCCGCCAGGTGCCGGCCTGGGCCGTCGTCGCGGTCTGCGCCGGCGTCGTGCTGCTGGCCTGG
GCGGCCCTGCGCCTGCAACTCGACCGCTGGACCGAGCAGGAACTGGCGCGCCTGCCGCCTGCCGTGCAGC
CGCTGGCCGAGCCGGCGCGGCTCAGCATCCGCTGGCCATGA