SecReT6
Protein ID: 383758884
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30310
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3219899..3221218 [-]
Producthypothetical protein
NoteTssK
UniProt IDI0HTN3
KEGG IDrge:RGE_30310
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-93, Aligned region: 19..437
Protein Sequence: 439 a.a.     [Download]
>gi|383758884|ref|YP_005437869.1| hypothetical protein RGE_30310 [Rubrivivax gelatinosus IL144]
MIPSAKILWGEGLFLRPQHFQRQDAYHEARLAQAMRWLRPHAWGLAALELDEDALATGLLRVLALQAVMP
DGEIVCAPRDDELPEPVPLEASPAAAMTWELVLEPMRADAANYAAGEDRRLAARYAAHTTEARDWFTGAP
EADLVVLRRRPRLQPASGTVAGLPLLRLCRSPAGWALDRDFVPPALVLAGAPALLALQRRMNERLRARLA
TLQGLRLGTAGLGADGRTADASALALAQAAGSACARLARLGPDSAPERLFGALLELAGALTAFAAEPSQE
LPAYLHADAGPGFAMLEALLRERLEAVASARWVDIVFDETRPSLRVARLDAAVPGPGGALYLSARAEMPL
AALIEAVPARLKLGAPDDLDRLVHSAVAGVRLVHAAQWPAALPLAPGACCFLVEPQGPWYERLLQARALA
VHVPDGLPGLRLGLHALLG
 
Nucleotide Sequence: 1320 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c3221218-3219899 Rubrivivax gelatinosus IL144, complete genome
ATGATCCCGTCCGCCAAGATCCTCTGGGGCGAAGGCCTGTTCCTGCGCCCGCAGCACTTCCAGCGCCAGG
ACGCTTACCACGAGGCGCGGCTGGCGCAGGCCATGCGCTGGCTGCGGCCGCACGCCTGGGGGTTGGCCGC
GCTGGAGCTCGACGAGGACGCGCTGGCGACCGGCCTGTTGCGCGTGCTGGCGCTGCAGGCGGTGATGCCC
GACGGCGAGATCGTCTGCGCGCCGCGCGACGACGAGCTGCCCGAGCCGGTGCCGCTCGAAGCGTCGCCGG
CCGCGGCCATGACCTGGGAGCTGGTGCTCGAACCGATGCGTGCCGATGCCGCCAACTACGCCGCCGGCGA
AGACCGCCGGCTCGCGGCGCGTTACGCCGCGCACACCACCGAGGCGCGCGACTGGTTCACCGGCGCGCCC
GAGGCCGATCTGGTCGTGCTGCGGCGGCGTCCGCGTTTGCAGCCGGCCAGTGGCACGGTTGCGGGCCTGC
CGCTCCTGCGCTTGTGCCGCAGCCCGGCCGGCTGGGCCCTGGACCGCGACTTCGTGCCGCCCGCGCTGGT
GCTCGCCGGCGCTCCGGCGCTGCTGGCGCTGCAGCGGCGCATGAACGAACGCCTGCGCGCCCGGCTGGCC
ACGCTGCAGGGCCTGCGCCTGGGCACGGCGGGCCTGGGCGCCGACGGTCGCACTGCCGATGCCTCGGCCC
TGGCCCTGGCGCAGGCCGCCGGCAGTGCCTGCGCCCGCCTCGCTCGCCTGGGGCCTGACAGCGCGCCCGA
GCGGCTCTTCGGTGCGCTGCTCGAGCTGGCCGGCGCGCTGACCGCCTTCGCCGCCGAGCCGTCGCAGGAA
CTGCCGGCCTATCTGCATGCCGATGCCGGCCCGGGTTTCGCGATGCTGGAGGCGCTGCTGCGCGAGCGGC
TGGAGGCCGTGGCCTCGGCGCGCTGGGTGGACATCGTTTTCGACGAGACGCGGCCCTCGCTGCGCGTGGC
ACGCCTGGACGCTGCCGTGCCCGGGCCGGGCGGTGCGCTGTACCTCTCGGCGCGGGCCGAGATGCCGCTG
GCCGCGCTGATCGAGGCCGTGCCGGCGCGGCTGAAGCTGGGCGCGCCCGACGACCTCGATCGCCTGGTGC
ACTCGGCCGTGGCCGGCGTGCGTCTGGTGCATGCGGCGCAGTGGCCGGCGGCGCTGCCGCTGGCGCCGGG
CGCCTGCTGCTTCCTCGTCGAGCCACAGGGGCCCTGGTACGAGCGCCTGCTCCAGGCGCGTGCGCTCGCG
GTGCACGTGCCCGACGGGCTGCCGGGCCTGCGCCTGGGCCTGCACGCCTTGCTGGGCTGA