SecReT6
Protein ID: 383758885
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30320
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3221226..3221798 [-]
Producthypothetical protein
NoteTssJ
UniProt IDI0HTN4
KEGG IDrge:RGE_30320
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.80E-19, Aligned region: 21..162
Protein Sequence: 190 a.a.     [Download]
>gi|383758885|ref|YP_005437870.1| hypothetical protein RGE_30320 [Rubrivivax gelatinosus IL144]
MPSICRPVVPLSCLLAAVSCGLLCGCATGSGTVPPWASQVLVAVGLQSPAPPPPPEALIELHASSLLNAA
SDGVALPTVVQLRWLDDPAAFQRAGYERLAAGDGARELVLAPGRTLSLRERVPVGAQALGVAALFRSPAP
GRWKLVFPLPAPQPIRLALHRCALVLVSGAAWEPPAGADRLGDLRCPSSE
 
Nucleotide Sequence: 573 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c3221798-3221226 Rubrivivax gelatinosus IL144, complete genome
ATGCCCAGCATCTGCCGCCCTGTCGTCCCGCTGTCCTGCCTGCTGGCCGCTGTGTCGTGCGGCCTGTTGT
GCGGCTGCGCCACCGGCTCCGGCACGGTCCCGCCCTGGGCTTCGCAGGTGCTGGTGGCGGTCGGCCTCCA
GTCGCCGGCGCCGCCACCGCCGCCCGAAGCGCTGATCGAGCTGCACGCCAGCAGCCTGCTCAACGCCGCG
AGCGACGGCGTGGCCCTGCCCACCGTCGTGCAGCTGCGCTGGCTCGACGACCCGGCGGCCTTCCAGCGCG
CCGGCTACGAGCGCCTGGCGGCCGGCGACGGCGCCCGCGAGCTGGTGCTGGCCCCCGGGCGCACGCTCAG
CCTGCGCGAACGTGTGCCGGTCGGCGCGCAGGCGCTCGGCGTGGCCGCCTTGTTCCGCTCGCCGGCGCCG
GGGCGCTGGAAGCTCGTGTTCCCGCTGCCGGCGCCCCAGCCCATCCGCCTGGCGCTGCATCGCTGCGCGC
TGGTGCTCGTCTCCGGTGCCGCCTGGGAGCCCCCGGCCGGCGCCGACCGCCTGGGAGACCTGCGATGCCC
GTCCTCGGAGTGA