SecReT6
Protein ID: 383758887
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30340
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3222693..3223208 [+]
Producthypothetical protein
NoteTssB
UniProt IDI0HTN6
KEGG IDrge:RGE_30340
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.90E-51, Aligned region: 11..165
Protein Sequence: 171 a.a.     [Download]
>gi|383758887|ref|YP_005437872.1| hypothetical protein RGE_30340 [Rubrivivax gelatinosus IL144]
MPRYDSIQSRLEKVRPPRVRLTYDVQVGDAIEHKELPFVVGVLGDFSGADGAATPRSRLKDRRFVPVDVD
SFDDVLRGVAPALRLRVADTLSPAGGELGVELHFERLEDFRPEAVVQQVEPLRRLLEARARLADLRNKMA
GNERLEDLLQQALREPAALAAIGHDAAPTGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|383755859|ref|NC_017075.1|:3222693-3223208 Rubrivivax gelatinosus IL144, complete genome
ATGCCCCGCTACGACAGCATCCAGTCCCGGCTCGAGAAGGTGCGGCCACCACGCGTGCGCCTGACCTACG
ACGTGCAGGTCGGCGACGCGATCGAGCACAAGGAACTGCCTTTCGTCGTCGGCGTGCTCGGCGACTTCAG
CGGTGCCGACGGCGCCGCCACGCCGCGCAGCAGGCTGAAGGACCGCCGCTTCGTGCCGGTCGACGTCGAC
AGCTTCGACGACGTGCTGCGCGGCGTCGCGCCGGCGCTTCGGCTGCGTGTCGCCGACACCTTGTCGCCCG
CGGGCGGCGAGTTGGGCGTCGAGCTGCACTTCGAGCGTCTCGAAGACTTCCGCCCCGAGGCCGTCGTGCA
GCAGGTCGAGCCACTGCGCCGGCTGCTCGAGGCGCGCGCGCGGCTGGCCGACCTGCGCAACAAGATGGCC
GGCAACGAACGCCTCGAGGACCTGCTGCAGCAGGCGCTGCGCGAGCCGGCGGCACTGGCCGCGATCGGCC
ACGACGCCGCGCCCACCGGGGAGTGA