SecReT6
Protein ID: 383758888
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30350
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3223213..3224685 [+]
Producthypothetical protein
NoteTssC
UniProt IDI0HTN7
KEGG IDrge:RGE_30350
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.80E-184, Aligned region: 63..485
Protein Sequence: 490 a.a.     [Download]
>gi|383758888|ref|YP_005437873.1| hypothetical protein RGE_30350 [Rubrivivax gelatinosus IL144]
MDTAVLTPIAPPGRDLLDSIVLDSRVARGEAEHGRARELIVHLAHEVRAGTVAVSENLGLALDARIAELD
ELISAQLSEILHHPRFQRLEAAWTGLHYLCRHAAGGPQQRIAIFDATRQELVRDFSTAVDFDQSALFRKV
YEEAFGTFGGAPFGALVGDYEIGRGAEDLYLVEQMSHVAAAAHAPFLAAASPELLGLDSFADIGRPRDLA
KVFDTAEYTRWKSLRASEDARYVGLVLPRFLGRLPYDARHGNAVEGFCFTERVDGSEHGRYLWVNAAYAL
AARLNAAFASYGWCAAIRGVEGGGLVEGLPAHAYRTDDGEHALKCPTEVAITDRREKELSDLGFIPLVHC
RNTDYAAFFAVQSVHKPRRYDSDAANANAALAAQLQYVFSVCRIAHYLKAMMREKVGSFASAANVEEFLN
RWIRQYVVEDDGATQETKAAYPLREASVQVSEIPGRAGAYRAVAFVRPHFQLDELSVSLRLVADLAPRGA
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|383755859|ref|NC_017075.1|:3223213-3224685 Rubrivivax gelatinosus IL144, complete genome
ATGGACACCGCCGTCCTGACCCCGATCGCGCCGCCCGGGCGCGACCTGCTCGACAGCATCGTGCTCGACA
GCCGCGTCGCGCGCGGCGAGGCCGAACACGGCCGCGCCCGCGAACTCATCGTGCACCTCGCGCACGAGGT
GCGCGCCGGCACGGTGGCCGTCTCCGAGAACCTCGGCCTGGCGCTGGACGCGCGCATCGCCGAACTCGAC
GAGCTGATCTCCGCCCAGCTCAGCGAGATCCTCCACCATCCGCGCTTCCAGCGCCTGGAAGCCGCGTGGA
CCGGGCTGCACTACCTCTGCCGCCATGCCGCCGGCGGGCCGCAGCAGCGCATCGCGATCTTCGACGCCAC
GCGCCAGGAGCTGGTGCGCGACTTCTCCACCGCCGTCGACTTCGACCAGTCGGCGCTGTTCCGCAAGGTC
TACGAGGAAGCCTTCGGAACCTTCGGCGGCGCGCCCTTCGGGGCGCTGGTCGGCGACTACGAGATCGGCC
GCGGCGCCGAGGACCTCTACCTCGTCGAGCAGATGTCGCACGTCGCCGCCGCGGCGCACGCGCCCTTCCT
GGCCGCGGCCTCGCCCGAGTTGCTGGGCCTGGACAGCTTCGCCGACATCGGCCGCCCGCGCGACCTGGCC
AAGGTCTTCGACACCGCCGAGTACACGCGCTGGAAGAGCCTGCGCGCCAGCGAGGACGCGCGCTACGTCG
GCCTGGTGCTGCCGCGTTTCCTCGGCCGCCTGCCCTACGACGCGCGCCACGGCAACGCCGTCGAAGGCTT
CTGCTTCACCGAGCGGGTCGACGGCTCGGAGCACGGGCGCTACCTGTGGGTCAACGCGGCCTACGCGCTG
GCGGCGCGGCTGAACGCGGCTTTCGCCTCCTACGGCTGGTGCGCGGCGATCCGCGGCGTCGAAGGCGGCG
GCCTGGTCGAGGGCCTGCCGGCGCACGCCTACCGCACCGACGACGGCGAACACGCGCTGAAGTGCCCGAC
CGAGGTCGCGATCACCGACCGGCGCGAGAAGGAACTGTCCGACCTGGGCTTCATCCCGCTGGTGCACTGC
CGCAACACCGACTACGCCGCGTTCTTCGCGGTGCAGTCGGTGCACAAGCCGCGGCGCTACGACAGCGACG
CGGCCAACGCCAACGCGGCGCTGGCGGCACAGCTGCAGTACGTCTTCAGCGTCTGCCGCATCGCGCACTA
CCTGAAGGCCATGATGCGCGAGAAGGTCGGCAGCTTCGCCTCGGCGGCCAACGTCGAGGAGTTCCTCAAC
CGCTGGATCCGCCAGTACGTCGTCGAGGACGACGGCGCGACGCAGGAGACCAAGGCCGCCTACCCGCTGC
GCGAAGCCAGCGTCCAGGTCAGCGAGATCCCCGGGCGCGCCGGCGCCTACCGCGCGGTGGCCTTCGTGCG
GCCGCACTTCCAGCTCGACGAACTGAGCGTCTCGCTGCGCCTGGTCGCCGACCTCGCGCCCCGCGGCGCC
TGA