SecReT6
Protein ID: 383758889
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30360
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3224706..3225224 [+]
Producthypothetical protein
NoteTssD
UniProt IDI0HTN8
KEGG IDrge:RGE_30360
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-36, Aligned region: 5..148
Protein Sequence: 172 a.a.     [Download]
>gi|383758889|ref|YP_005437874.1| hypothetical protein RGE_30360 [Rubrivivax gelatinosus IL144]
MKDIYVKFDGASELLGDSSDSKHANEIEVSAFQHRVFQPRSSTASSSGGHTAERTEHGEMLFTKLIDRAT
PKLLRAASAGTLYPKVLVTFYRAYGGKNATATSQSRIDYYRIVLEDVVVSSVETRVDEDELPCETFGLRY
GKVTWEYKQHKLDGSATSTGVAGWDLRRNVAV
 
Nucleotide Sequence: 519 bp     [Download]
>gi|383755859|ref|NC_017075.1|:3224706-3225224 Rubrivivax gelatinosus IL144, complete genome
ATGAAGGACATCTACGTCAAGTTCGACGGCGCCAGCGAGCTGCTCGGCGACAGCAGCGACTCCAAGCACG
CCAACGAGATCGAGGTCTCGGCCTTCCAGCACCGCGTCTTCCAGCCGCGCTCGTCGACCGCCTCGTCCTC
CGGCGGCCACACCGCCGAGCGCACCGAGCACGGCGAGATGCTGTTCACCAAGCTGATCGACCGCGCCACG
CCCAAGCTGCTGCGCGCCGCTTCGGCCGGCACGCTCTACCCCAAGGTGCTGGTCACCTTCTACCGCGCCT
ACGGCGGCAAAAACGCGACCGCGACCTCGCAGTCGCGCATCGACTACTACCGCATCGTGCTCGAGGACGT
CGTCGTGTCCTCGGTCGAAACGCGTGTCGACGAAGACGAGCTGCCCTGCGAGACCTTCGGCCTGCGCTAC
GGCAAGGTCACCTGGGAATACAAGCAGCACAAGCTCGACGGCTCGGCCACCAGCACCGGCGTCGCCGGCT
GGGACCTGCGGCGCAACGTCGCCGTCTGA