SecReT6
Protein ID: 383758890
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30370
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3225232..3225681 [+]
Producthypothetical protein
NoteTssE
UniProt IDI0HTN9
KEGG IDrge:RGE_30370
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.40E-12, Aligned region: 30..121
Protein Sequence: 149 a.a.     [Download]
>gi|383758890|ref|YP_005437875.1| hypothetical protein RGE_30370 [Rubrivivax gelatinosus IL144]
MAGASLLETMLGEPVPDAGAAAPARQDALGLARDIERLLNTRSAWPSERLPRWPRVARSVYAFGFADAGA
DGDGTEALHRLAERIRQALAAHEPRLADLRVSPRPGARRPPAFTIEATLRRPGTRLSFDAEIAPGRHRCV
VAPVAGPAA
 
Nucleotide Sequence: 450 bp     [Download]
>gi|383755859|ref|NC_017075.1|:3225232-3225681 Rubrivivax gelatinosus IL144, complete genome
ATGGCTGGCGCTTCGCTGCTGGAGACGATGCTGGGCGAGCCCGTGCCCGACGCCGGCGCGGCGGCCCCGG
CACGCCAGGACGCCCTGGGCCTCGCCCGTGACATCGAACGGCTGCTCAACACCCGCAGCGCCTGGCCGTC
CGAGCGGCTGCCACGCTGGCCGCGTGTCGCGCGTTCGGTCTACGCCTTCGGCTTCGCCGACGCCGGGGCC
GACGGCGACGGCACCGAGGCGCTGCACCGGCTGGCCGAACGCATCCGCCAGGCGCTCGCGGCGCACGAAC
CGCGGCTGGCCGATCTGCGCGTGAGCCCGCGGCCGGGTGCGAGGCGGCCGCCGGCGTTCACCATCGAAGC
GACGCTGCGCCGCCCCGGCACGCGGCTGAGCTTCGACGCCGAGATCGCGCCCGGCCGGCATCGCTGCGTC
GTCGCTCCGGTCGCGGGGCCCGCCGCCTGA