SecReT6
Protein ID: 383758892
SecReT6 ID566
T6SS typei4b
Gene symbol-
Locus tagRGE_30390
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]3227527..3228522 [+]
Producthypothetical protein
NoteTssG
UniProt IDI0HTP1
KEGG IDrge:RGE_30390
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-58, Aligned region: 17..308
Protein Sequence: 331 a.a.     [Download]
>gi|383758892|ref|YP_005437877.1| hypothetical protein RGE_30390 [Rubrivivax gelatinosus IL144]
MSPIPPMARSPIERLLAEPAAFAPYPALRLLRRWLAADGRPGRPRLRWRASTAMSAPAAEIESLRLRPAE
SGEAAEFELVAAFGSLLGLHGALPAAYTETLLERRDPAALAFVELFQQRLGEWGEQAWRHARPALDAETT
GPERLLAALQALAGLAGAGLPAPARAFHAGALATGRPSAAALERVLAHQFDTRVRVHAWQGRWHRLPSEA
LGRLGLRAVSLGHDAVAGARVWQRDLDLRLDIGPLPRARFDALLPGADGAGALAAWWQALAGGGLDAEAR
LLLRAEDRRPAVLGGTCAARLGFDAFLPERGPLQDRAAATLRLAGLSRSAA
 
Nucleotide Sequence: 996 bp     [Download]
>gi|383755859|ref|NC_017075.1|:3227527-3228522 Rubrivivax gelatinosus IL144, complete genome
ATGTCGCCGATACCACCGATGGCCCGTTCCCCGATCGAGCGCCTGCTCGCCGAACCCGCGGCTTTCGCGC
CCTATCCGGCGCTGCGGCTGCTGCGGCGCTGGCTGGCCGCCGACGGCCGGCCCGGGCGGCCGCGGCTGCG
CTGGCGCGCCAGCACGGCGATGTCGGCACCGGCCGCGGAGATCGAGTCGCTGCGGCTGCGGCCGGCGGAG
TCGGGCGAGGCCGCCGAGTTCGAACTCGTCGCCGCCTTCGGCTCGCTGCTCGGCCTGCACGGCGCGCTGC
CGGCGGCTTACACCGAAACGCTGCTCGAACGCCGCGACCCGGCCGCACTGGCTTTCGTCGAGCTGTTCCA
GCAGCGCCTGGGCGAATGGGGCGAGCAGGCCTGGCGCCACGCACGGCCGGCGCTGGACGCCGAGACCACC
GGCCCCGAGCGCCTGCTCGCCGCGCTGCAGGCGCTGGCCGGACTGGCCGGCGCCGGCCTGCCGGCACCCG
CGCGGGCTTTTCACGCCGGAGCGCTGGCCACCGGGCGGCCGTCGGCAGCGGCGCTGGAACGCGTGCTGGC
GCATCAGTTCGACACCCGGGTGCGTGTGCACGCCTGGCAAGGCCGCTGGCACCGCCTGCCCTCCGAAGCC
CTGGGACGGCTGGGTTTGCGCGCCGTCTCGCTGGGCCACGACGCCGTGGCCGGCGCCCGGGTCTGGCAGC
GTGACCTGGATCTGCGCCTGGACATCGGCCCGCTGCCGCGCGCCCGCTTCGACGCGCTGCTGCCCGGCGC
CGACGGCGCCGGTGCGCTGGCCGCCTGGTGGCAGGCGCTGGCAGGCGGCGGGCTCGACGCCGAGGCCCGC
CTGCTGCTGCGCGCCGAGGACCGGCGGCCCGCGGTGCTGGGCGGCACCTGCGCCGCACGGCTGGGTTTCG
ACGCCTTCCTGCCGGAACGCGGCCCGCTGCAGGACCGCGCCGCGGCCACGCTGCGGCTCGCCGGCCTCAG
CCGGAGCGCGGCATGA