SecReT6
Protein ID: 384121028
SecReT6 ID568
T6SS typei3
Gene symbol-
Locus tagYPD4_0436
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]528346..529359 [+]
Producthypothetical protein
NoteTssA
UniProt IDD0JEL1
KEGG IDypd:YPD4_0436
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.20E-08, Aligned region: 183..203
Protein Sequence: 337 a.a.     [Download]
>gi|384121028|ref|YP_005503648.1| hypothetical protein YPD4_0436 [Yersinia pestis D106004]
MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISEQANKLLEQCF
DLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNSGHAAALGWLSTAQCIAELKT
ARLTEEHPYILQDLITTEALPNGQERYFVTSSTLFLTVNNYFQQNGLPDLKDQLTKVDMLLEQIESYANQ
STESYQLHCEQLRIFLKNNISQLAQLNAPEHDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLD
RILEYFQHYEPSHPAPIFIRRTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|384120592|ref|NC_017154.1|:528346-529359 Yersinia pestis D106004 chromosome, complete genome
TTGATTTTAAAACGGATGGACAATAATATGAGTGACATATTTCCTCAAGCATTATTCGGCGTTGAATATG
ATCCGGCCTATGGCGAGATTGAGTCCATCCTCTCTCAATTAGATGAGTCTGCGGACCCCCTTTCCCGCCC
GCATGAACCCCCTCAAATAAACTGGCACCATATCAGTGAGCAAGCCAATAAGCTGCTAGAGCAATGTTTT
GATTTACGTGTAATGCTTTGGTTTATAAGGGCAAATATTCATATAAAAGGAATATCGGCCCTCTATGATG
GCTTTATGCGCATTAATGCACAAACCCAAGATACTGATGTTGTTATCTACCCTCAATCGGAAGAACCGCC
ATTAAATAGTGGGCATGCCGCCGCATTAGGTTGGTTATCTACAGCACAATGTATTGCAGAGCTTAAGACT
GCACGCCTTACAGAAGAGCACCCTTACATTTTACAAGATCTTATTACGACTGAAGCGTTACCCAATGGCC
AAGAGAGATATTTTGTTACATCTTCGACATTATTTTTAACTGTCAATAATTATTTCCAACAGAATGGATT
GCCAGATTTAAAAGACCAATTGACAAAAGTAGATATGTTGTTGGAACAAATTGAGTCCTATGCAAATCAA
TCCACAGAGAGTTACCAACTGCATTGTGAACAATTACGTATTTTCTTAAAAAATAATATTTCTCAGCTTG
CACAATTGAATGCCCCAGAACATGACGATCCCGAAACTGTTTATCAAAAAATAGACAGTCATGAATCTCT
TGATACTCAGTCCTTTAATTCAAATGATAAGAGCATTCGCTCACGGCAAGAGATCATTATGATGCTGGAC
CGTATTCTAGAGTACTTTCAACATTATGAGCCTAGTCATCCAGCCCCAATATTCATTCGCCGTACCAAAG
AGATGATAGGTATGGATTTTTATTCCATTGTTGAAGAAATTCTGCCTGAAGCTGTAATTACATTAAAACA
GTTTACCGGAAAAACTAACCTACCGTTTCGATGA