SecReT6
Protein ID: 384121042
SecReT6 ID568
T6SS typei3
Gene symbol-
Locus tagYPD4_0450
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]544903..545376 [+]
Productlipoprotein
NoteTssJ
UniProt IDD0JEM5
KEGG IDypd:YPD4_0450
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-17, Aligned region: 10..149
Protein Sequence: 157 a.a.     [Download]
>gi|384121042|ref|YP_005503662.1| lipoprotein [Yersinia pestis D106004]
MLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLKVCIIELNKEGWSPPGL
YQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLTLKSDARADFN
RVVLVDGKALSLKASTK
 
Nucleotide Sequence: 474 bp     [Download]
>gi|384120592|ref|NC_017154.1|:544903-545376 Yersinia pestis D106004 chromosome, complete genome
GTGTTGCCTATTTTTATCCTGACAGGTTGCGTCCTGCTCAGCGGCTGTAGCTGGTTTTCCTCATCCTCAG
AAGCGGCGCTACAGAAACGGCGGATTGACTTGCAGGTTGTTGCGGCTCCTCTCATCAATCCTGGGCCCAA
CGGTCAGGCACAGCCCTTGAAGGTATGCATTATTGAGCTGAATAAAGAGGGGTGGTCACCCCCCGGTTTG
TATCAGGGGACGCTCTGCAGTGGCATCAGTGTAGGAGGTGAAGTCGTCAGCGTGACGGAATACATCCTTG
CGCCGACAGAGGTGCGTCAATATTCCCGCGATGTTCCCTTTGAACAAGAGCGCTGGTGGGCAATAGCGGC
TGAGTTTCAGGAGATGAGTAACGGTAAAAGCCTATTAACGCTGAAATCTGATGCCCGTGCGGACTTCAAC
CGTGTGGTGCTCGTTGATGGTAAGGCCCTGTCATTAAAAGCGTCAACAAAGTAG