SecReT6
Protein ID: 384121043
SecReT6 ID568
T6SS typei3
Gene symbol-
Locus tagYPD4_0451
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]545496..546851 [+]
Producthypothetical protein
NoteTssK
UniProt IDD0JEM6
KEGG IDypd:YPD4_0451
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-121, Aligned region: 19..446
Protein Sequence: 451 a.a.     [Download]
>gi|384121043|ref|YP_005503663.1| hypothetical protein YPD4_0451 [Yersinia pestis D106004]
MLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGFHSLSINQGLLDQGKIALNQASGVFP
DGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLMDIPGNTYIDLKKSNQGSRFVALDAEVQDRNHGVAAE
GTPLIATLQLGQLQSKLTLRASVSDAESMLPVAYIKERTRDGRLILDDNFLPPMLDFRAIGWIDNAVTEL
LGLIVQRLESVYRPDVTLSVGGLSELLELLLLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLLGRLSTI
PGGEKPWSRQDLLYTHHEPHNGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQNDSQLRLEKLIF
TVSSKLPSETIRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRYIPYYPNSVYFEVDHDDPMYKE
MMSGSAIALSIVGDFPELRFEVWGLRQGRLG
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|384120592|ref|NC_017154.1|:545496-546851 Yersinia pestis D106004 chromosome, complete genome
ATGCTGCCAAAACAACGTGTTGCTTGGGTGGAAGGGATGCTGATGGAACCCCAGCATTTTCAACAACAGG
AACGATATCTAGAACATTTAACTGAAATGCGGGCACGTAGCCTCAGCGCGCTGGCATGGGGCTTCCATAG
CCTAAGTATCAATCAAGGGCTGCTGGATCAGGGCAAGATCGCCCTCAATCAGGCCAGTGGTGTTTTCCCT
GACGGTACACCTTTTCATATGGCGGGTGATGAGCCATTACCGCTACCTTTTGATCCGGGGGAGAACTGCC
AAGGCAGTGTCGTGTGCCTTTCGGTCCTGATGGATATACCCGGCAATACCTATATTGATCTGAAGAAGAG
CAACCAAGGTAGCCGTTTCGTTGCGCTGGATGCTGAAGTTCAAGACAGAAACCATGGCGTCGCTGCTGAA
GGAACGCCATTGATCGCCACCCTTCAACTGGGGCAATTGCAATCCAAGCTCACCTTACGTGCCAGCGTCA
GTGATGCAGAATCGATGCTGCCCGTAGCCTATATCAAAGAGCGCACCCGCGATGGGCGTCTGATTCTGGA
TGATAACTTCCTGCCACCCATGTTGGATTTTCGCGCCATAGGGTGGATCGATAATGCGGTAACCGAATTG
CTAGGGTTGATCGTTCAGCGACTGGAATCGGTTTACCGGCCAGATGTGACGCTCTCAGTCGGTGGGTTAT
CGGAGTTACTGGAACTGCTATTACTGCAAACACTCAGTGAATATAACCTAAAGATTTCACATGTGTTGAT
GCAAAAACAGGTACACCCTGAGCAGTTGTTCCAATTATTGCTTGGGTTGTTGGGGCGTCTCAGTACTATC
CCTGGCGGAGAAAAACCGTGGTCGAGGCAGGATCTGCTCTATACGCATCATGAACCGCACAACGGGTATT
TCTCGCTGTTTGCCGCCTTACGGCGCGCACTCTCACTGGTGATCGAAGCACCGGCAGTGGCGCTACCGTT
TATCGAACGTGGCGACAATATTTACCTGTGCCAGAACGATTCACAACTGCGTCTGGAAAAACTGATCTTC
ACCGTCAGTTCCAAACTGCCTTCCGAGACCATTCGCACTTACTTCCCGGCGCAAACCAAACTGGGGCCGG
TGGAGAAAATTGTACAGTTGATCGACCTGCAATTGCCTGGCGCACGGATGATCCCGATGTCATCACCGCC
AAGATATATTCCTTATTACCCGAATAGCGTCTATTTCGAAGTTGACCATGATGATCCTATGTATAAAGAA
ATGATGTCTGGTTCAGCTATCGCACTCAGCATCGTGGGTGATTTCCCTGAGTTGCGTTTTGAAGTATGGG
GCTTGCGACAAGGAAGGCTCGGATGA