SecReT6
Protein ID: 384121044
SecReT6 ID568
T6SS typei3
Gene symbol-
Locus tagYPD4_0452
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]546848..548458 [+]
Producthypothetical protein
NoteTssL
UniProt IDD0JEM7
KEGG IDypd:YPD4_0452
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-43, Aligned region: 143..338
OmpA [PF00691], Evalue: 1.20E-12, Aligned region: 398..501
Protein Sequence: 536 a.a.     [Download]
>gi|384121044|ref|YP_005503664.1| hypothetical protein YPD4_0452 [Yersinia pestis D106004]
MNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEGLADQAASGN
NMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYERPGMLLGAW
DNAYIAAAMPLLLLVENIRSWPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLLCTYIDGIFN
GLQTPDSYNQSLLVEFHRDAWGGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQMIEHGAVLLM
DLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQSQQIRSNIL
TWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFINKKNIERLGL
ALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAIGRGESDPLAD
NATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ
 
Nucleotide Sequence: 1611 bp     [Download]
>gi|384120592|ref|NC_017154.1|:546848-548458 Yersinia pestis D106004 chromosome, complete genome
ATGAACGAATTTGAACGCCAGATCCGTGCAGCCATTTCCGCAGCACGCAATGGCGCAAAACATGCGGAAC
AGTCACTGACTACACCAATGTGGCAAGCCAAAAGCACCGTAGCCTCATTGGGTGGGATTGTCCCTAGAAG
TGGCTCTTCGTCAACGTCACAGGCGGAGAACTATAAGGAAGGTCTCGCGGACCAGGCTGCCTCGGGCAAC
AACATGGCGCGCACGAGTGCGCCACCGGTCACTTTGTATCAGCAACAGCCAAATGCGAATGACAGCTATC
CAAACGGGAATAACAACAATCCAAACGGGGATAACAACAATCCAAACGGGAGTAACAACAATATAGCGAG
AGTACAGCGTATGCCGCATGGCATTTCCAGGGGCTTATATGAGCGCCCTGGGATGTTATTGGGTGCCTGG
GATAACGCCTATATTGCTGCGGCTATGCCTTTGCTGCTGCTGGTGGAAAATATTCGTAGCTGGCCGACGC
GTAACGCCGCAGAGGTCAGGCCACCGATTGTGCGGGAATTACAATATTTCCAGCAACATTTGCAGAAAAA
GAACTACCCGCAAGAAGACATTAACCACCTGTCTTACCTGCTATGTACCTATATCGATGGCATTTTTAAC
GGGCTGCAAACCCCAGACTCCTACAACCAAAGTCTGTTAGTGGAGTTTCACCGTGATGCCTGGGGGGGTG
AGGACTGCTTCGAACATCTGCGGGTCTATATGAACTCGCCGAAACAGTACCGGGAAGTTCTGGAATTCTA
TGATCTGATTATGTGCCTTGGTTTTGACGGTAAATACCAGATGATAGAGCATGGTGCGGTTCTGCTGATG
GATTTACGCAGCCGTCTCCACACGCAACTCTACGGTCAGGACGCCACACAATCTTTGGCTATCGCGCAAG
CGGTCAAAGGTTCTCCGCGTCGCCAATATATCAAGGCGCTGAAAATCTTCACCTATGGTTTCGCACTGTG
CCTTTGTGCTTACGGCGTCACGGCGTGGTATCTGCACCAGCAATCCCAACAGATCCGCAGCAACATTCTG
ACGTGGGTACTGCCTGAACCGCGGAAAATCAACATCATGGAGACCTTGCCGAATCCGCTATCCAACATCC
TGAATGAAGGGTGGCTGGAGGTCAGGAAAGATCCGCGTGGATGGCTATTAATCTTCACCTCCGACGGCGC
GTTCCGCACGGGTGAAGCGACCCTCTCGGAAGAGTTTATCAACAAGAAGAATATCGAACGTCTTGGGCTG
GCATTAGCCCCATGGCCGGGAGATATCGAGGTTATTGGTCATACGGATAACAAACCGTTCCGTAGCACTT
CCGGTAACAACAACCTCAAACTTTCCGCGGCCAGAGCATCGGTGGTGGCAGATAAACTGCGGGAATCCAC
TCAAATCAACGAAACCCATCAGCGAGAAATAAGTGCCATCGGACGGGGGGAGAGCGATCCTTTAGCTGAC
AATGCAACGGAAGAAGGGCGCAAGCGTAACCGGCGTGTGGATATCCTATGGAAAATTGGTCAGCGCGATG
CCGATAAGGCCATGAAGCAATTCCTGGAGAACCCAACACCAGAAGTTCAAGGAACGAATACCCAACAATA
G