SecReT6
Protein ID: 384121305
SecReT6 ID569
T6SS typei2
Gene symbol-
Locus tagYPD4_0713
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]917116..918654 [+]
Producthypothetical protein
NoteTssC
UniProt IDD0JG54
KEGG IDypd:YPD4_0713
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.10E-175, Aligned region: 14..51
DUF877 [PF05943], Evalue: 9.10E-175, Aligned region: 90..508
Protein Sequence: 512 a.a.     [Download]
>gi|384121305|ref|YP_005503925.1| hypothetical protein YPD4_0713 [Yersinia pestis D106004]
MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSVFL
DLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELL
DISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHM
PFIGSVGPEFFGKENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKLIQRENIGTTKDRRLLELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYAVP
HFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|384120592|ref|NC_017154.1|:917116-918654 Yersinia pestis D106004 chromosome, complete genome
ATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGGCACAAG
GGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGAGGCGTT
CCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTCTTTTTA
GACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATATTGCCG
CACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGTGGAATC
GACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAGCTGCTG
GATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTTTATACG
CCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAGCCGATTGCCGCGGCTATCTCCAACTACGA
GTTCGACCGTAGCCCGCAAGATATCGCGTTATTGCGCAATATCTCCAAGGTCGCGGCGGCAGCCCATATG
CCGTTTATCGGTTCCGTTGGCCCCGAGTTCTTTGGTAAAGAGAACATGGAAGACGTGGCAGCCATCAAAG
ATATCGCCAACTACTTTGACCGTGCTGAATACATCAAGTGGAAAGCCTTCCGCGACTCGGATGATTCCCG
CTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCTTACGGCCCGGACACGGTGCCGGTACGC
AGCTTCAACTACGTTGAGCAGGTGAAAGGGCCGGATCATGATCGCTACTTGTGGACCAATGCCTCATTTG
CCTTTGCTGCTAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGGGGCCCGCAGGC
CGGTGGTGCGGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGACACCGC
GGATGCCACGGCCAACAGCCGCATCAACGCCCGTTTGCCGTATATCTTCCTGCTGTCGCGCATTGCCCAT
TATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTGAACAACT
GGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCATCCCCTGCGTGA
TGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTGTATGCGGTGCCG
CATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCAAAGGCTAAGGCATAA