SecReT6
Protein ID: 384121306
SecReT6 ID569
T6SS typei2
Gene symbol-
Locus tagYPD4_0714
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]918771..920018 [+]
Producthypothetical protein
NoteTssK
UniProt IDD0JG55
KEGG IDypd:YPD4_0714
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.10E-130, Aligned region: 4..412
Protein Sequence: 415 a.a.     [Download]
>gi|384121306|ref|YP_005503926.1| hypothetical protein YPD4_0714 [Yersinia pestis D106004]
MAVMHPWGVLQATFELDALAQGRLKAARLHVRFQDGVLVDTECADVLPPTLTLAASLPAEASDATVMLAI
PQLYANGGNCLQPDERGERPVRYRQAWRDVQNQFGDDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLR
DAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMRRESNARMADFAVADVSLFWLLNA
LNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLTFSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEA
SLPSRVVAIELVHEPRINQWRATLRDPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNV
ALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAATQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|384120592|ref|NC_017154.1|:918771-920018 Yersinia pestis D106004 chromosome, complete genome
ATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGCCACTTTTGAATTGGATGCATTGGCACAGGGCCGCC
TGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGACGGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCT
GCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCGCCGAGGCCAGCGACGCCACGGTGATGCTGGCGATA
CCACAACTGTATGCCAATGGCGGTAACTGCCTGCAGCCGGATGAGCGGGGCGAACGCCCGGTACGCTATC
GTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGCGATGACAAAAAGCAGGTCGCGGTGATGTACCACCA
ACTGACCCTGCGGCTGGACACTCAGGAAAACGGCGATTATCAGGTCTGCCCGGTGGCGCGTTTGCTGCGG
GATGCGCAAGGTCGCTGGACACTGGATCCGGGCTTTATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCT
GGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAACTGCGGGCGCGTTTGCAGCGTCTGATGGGGATGCG
CCGGGAGAGCAATGCACGGATGGCCGATTTTGCTGTTGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCC
CTTAACAGTGCCGAACCGGTATTGGGGAATTTTCAGCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATC
AGGAACTGGCCAGGCTGGCGGGCAGCCTGCTGACGTTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGT
TTATCAGCATGAACAACTGACCCGCGTCTTTCCCCCGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCC
AGCCTCCCTTCACGGGTAGTGGCGATTGAGCTGGTTCATGAACCGCGTATCAATCAGTGGCGCGCGACCC
TGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTCTACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCA
ATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCGGTGCGCCGGATGAGGTCGGTAACGTGGTGAATGTT
GCGCTGAGTGGGATCCCACTGCGCCCGCTGAGCCATGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACC
AGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCGACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTA
TGTACCCGGTACGCTGGGTGAGATCCAACTGGAGCTGTTTGCGGTGCTACGCGCATGA