SecReT6
Protein ID: 384121312
SecReT6 ID569
T6SS typei2
Gene symbol-
Locus tagYPD4_0720
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]925964..928312 [+]
Producthypothetical protein
NoteTssI
UniProt IDD0JG61
KEGG IDypd:YPD4_0720
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-64, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 1.30E-47, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 4.30E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 4.30E-35, Aligned region: 629..650
Phage_base_V [PF04717], Evalue: 8.80E-16, Aligned region: 390..481
Protein Sequence: 782 a.a.     [Download]
>gi|384121312|ref|YP_005503932.1| hypothetical protein YPD4_0720 [Yersinia pestis D106004]
MNTFLPTIRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIGPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADLTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALAPGQELNVTGNDVPAQFGKGVIITRI
TSHARRDRSYEVHFEAIPYSEDYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWESGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIAYVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGVLRAEKGLFITAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPADLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQMSASDNLIATAGKNADVSVAKNFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELL
ARKAITITSTEDEIKITAKKRITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAA
KTEDPIKRWLFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|384120592|ref|NC_017154.1|:925964-928312 Yersinia pestis D106004 chromosome, complete genome
ATGAATACCTTTCTCCCGACTATTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCATGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGGCCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTCACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
ATCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAATCGGTCTGGGACCTGT
CCAGCGCCCATCAGGTGGTGGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCCACTGCCGA
CCTGACCGCCGGGGCCGACATCACGCGCGGCGATACCACCACCTACGGCGAAGCCTATCATTACGCCGAT
AACTATCTGACCGCAGGCAGCGAAGGGCGCGAGCCGGAAAGTGAAAGTGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGGCACCGGG
TCAGGAACTGAACGTCACCGGCAACGACGTGCCAGCACAGTTTGGTAAAGGGGTGATAATCACCCGCATC
ACCAGCCATGCCCGCCGCGACCGCAGCTATGAAGTACATTTTGAAGCCATTCCTTACTCCGAGGATTATT
GCTTCCGTCCGGCGCTGATCCGCAAGCCGACCATGGCCGGGACCTTGCCGGCGCGGGTGACCAGTACCAC
TGCGAACGACACTTATGGTCATATCGACAAAGACGGGCGCTACCGTGTCAACCTGATGTTCGACCGTGAC
AGTTGGGAGTCGGGTTACGAAAGCTTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCAGGCACCGAAGTGGCGATCGCGTTTGAAGACGGCAACCCGGACCGGCCGTA
TATCGCCTATGTGCTACACGACTCGGCGCACGGCGACCATGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGTACTCCGTCGAATAACAAACTGCGCCTGGAGGATGAACGGGGTAAAGAGCACATCAAGCTCAGCA
CCGAATATGGCGGCAAAAGCCAACTGAATCTGGGGCATTTGGTTGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGTATTACGGGCAGAAAAAGGCCTCTTTATCACTGCCGAC
GGACAGGCCAAAGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGTAGCGGGGAGCATCTGCAAATGAGTGCCAGCGATAACCTGATTGCCACCGCCGGTAAAAATG
CCGACGTCAGCGTCGCGAAAAATTTCTTTATCGGCGTAGGCAATACCCTAAGTATCTTCGTCAGAAAGCT
GGGGATGAAACTAATAGCCAATCAGGGGCCGATAACAGTCCAGGCGCAGAATGATCTAATGGAGTTATTG
GCGCGTAAAGCGATCACCATTACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAGGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAATCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGGTTAGATAAGGCCAAACTCCCAACTGAATTTCCAGCCTTAGCCGCT
AAAACTGAAGACCCCATTAAACGTTGGCTATTCTCTTAA