SecReT6
Protein ID: 384121891
SecReT6 ID570
T6SS typei2
Gene symbol-
Locus tagYPD4_1300
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]1667977..1668477 [+]
Producthypothetical protein
NoteTssB
UniProt IDD0JJB0
KEGG IDypd:YPD4_1300
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.90E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|384121891|ref|YP_005504511.1| hypothetical protein YPD4_1300 [Yersinia pestis D106004]
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVALTFREMKDFEPESVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|384120592|ref|NC_017154.1|:1667977-1668477 Yersinia pestis D106004 chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCGCTT
TGACCTTCCGCGAGATGAAAGATTTCGAACCGGAAAGCGTCGCCCGTCAAATCCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTCAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCACCAA
AAGAGGGTTAA