SecReT6
Protein ID: 384121893
SecReT6 ID570
T6SS typei2
Gene symbol-
Locus tagYPD4_1302
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]1670187..1671434 [+]
Producthypothetical protein
NoteTssK
UniProt IDD0JJB2
KEGG IDypd:YPD4_1302
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-128, Aligned region: 4..412
Protein Sequence: 415 a.a.     [Download]
>gi|384121893|ref|YP_005504513.1| hypothetical protein YPD4_1302 [Yersinia pestis D106004]
MAVMHPWGVLQATFELDALAQGRLKAARLHVRFQDGVLVDTECADVLPPTLTLAASLPVEASDATVMLAI
PQLYANGGNCLQPDERGERPVRHRQAWRDVQNQFGDDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLR
DAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMRRESNARMADFAVADVSLFWLLNA
LNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLTFSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEA
SLPSRVVAIELVHEPRINQWRATLRDPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNV
ALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAATQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|384120592|ref|NC_017154.1|:1670187-1671434 Yersinia pestis D106004 chromosome, complete genome
ATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGCCACTTTTGAATTGGATGCATTGGCACAGGGCCGCC
TGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGACGGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCT
GCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCGTCGAGGCCAGCGACGCCACGGTGATGCTGGCGATA
CCACAACTGTATGCCAATGGCGGTAACTGCCTGCAGCCGGATGAGCGGGGCGAACGCCCGGTACGCCATC
GTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGCGATGACAAAAAGCAGGTCGCGGTGATGTACCACCA
ACTGACCCTGCGGCTGGACACTCAGGAAAACGGCGATTATCAGGTCTGCCCGGTGGCGCGCTTGCTGCGG
GATGCGCAAGGTCGCTGGACACTGGATCCGGGCTTTATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCT
GGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAACTGCGGGCGCGTTTACAGCGTCTGATGGGGATGCG
CCGGGAGAGCAATGCACGGATGGCCGATTTTGCTGTCGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCC
CTTAACAGTGCCGAACCGGTACTGGGGAATTTTCAGCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATC
AGGAGCTGGCCAGGCTGGCGGGCAGCCTGCTGACGTTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGT
TTATCAGCATGAACAACTGACCCGCGTCTTTCCCCCGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCC
AGCCTCCCATCACGGGTGGTGGCGATTGAGCTGGTTCATGAACCGCGTATCAATCAGTGGCGCGCGACCC
TGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTCTACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCA
ATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCGGTGCGCCAGATGAGGTCGGTAACGTGGTGAATGTC
GCGTTGAGCGGGATCCCACTGCGTCCGCTGAGCCATGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACC
AGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCGACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTA
TGTACCCGGTACGCTGGGTGAGATCCAACTGGAGCTGTTTGCGGTGCTACGCGCATGA