SecReT6
Protein ID: 384121894
SecReT6 ID570
T6SS typei2
Gene symbol-
Locus tagYPD4_1303
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]1671431..1672117 [+]
Producthypothetical protein
NoteTssL
UniProt IDD0JG56
KEGG IDypd:YPD4_0715, ypd:YPD4_1303
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-47, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|384121894|ref|YP_005504514.1| hypothetical protein YPD4_1303 [Yersinia pestis D106004]
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLATLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|384120592|ref|NC_017154.1|:1671431-1672117 Yersinia pestis D106004 chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGCCCTGTTGCAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAGACCGTGAAAGGGCGCGGTGTACAGGATGATGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGTAGCCAGCTTTACGAGCG
GATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGATCGCGCGGTACTGACCTGTTTTCACCGGGTATTGATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCACGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGTTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTCGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTGTCCGGTCTGTTAGCCACCTTACTGCCGGAGCCGGTGTAA