SecReT6
Protein ID: 384121897
SecReT6 ID570
T6SS typei2
Gene symbolclpB3
Locus tagYPD4_1306
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]1674766..1677414 [+]
ProductClp ATPase
NoteTssH
UniProt IDD0JJB6
KEGG IDypd:YPD4_1306
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-40, Aligned region: 237..257
AAA_2 [PF07724], Evalue: 1.80E-40, Aligned region: 611..775
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 239..351
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 616..734
AAA_5 [PF07728], Evalue: 1.70E-14, Aligned region: 239..263
AAA_5 [PF07728], Evalue: 1.70E-14, Aligned region: 615..736
ClpB_D2-small [PF10431], Evalue: 4.20E-14, Aligned region: 783..860
AAA_16 [PF13191], Evalue: 2.60E-13, Aligned region: 115..197
AAA_16 [PF13191], Evalue: 2.60E-13, Aligned region: 216..261
AAA_16 [PF13191], Evalue: 2.60E-13, Aligned region: 284..317
AAA_16 [PF13191], Evalue: 2.60E-13, Aligned region: 471..531
AAA_16 [PF13191], Evalue: 2.60E-13, Aligned region: 584..659
AAA_16 [PF13191], Evalue: 2.60E-13, Aligned region: 680..710
AAA_16 [PF13191], Evalue: 2.60E-13, Aligned region: 754..807
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 238..324
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 614..652
AAA_25 [PF13481], Evalue: 2.40E-08, Aligned region: 239..312
AAA_25 [PF13481], Evalue: 2.40E-08, Aligned region: 613..644
Arch_ATPase [PF01637], Evalue: 4.10E-07, Aligned region: 217..255
Arch_ATPase [PF01637], Evalue: 4.10E-07, Aligned region: 291..391
Arch_ATPase [PF01637], Evalue: 4.10E-07, Aligned region: 609..656
IstB_IS21 [PF01695], Evalue: 5.10E-07, Aligned region: 232..300
IstB_IS21 [PF01695], Evalue: 5.10E-07, Aligned region: 615..635
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 239..325
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 615..636
Zeta_toxin [PF06414], Evalue: 6.50E-06, Aligned region: 234..263
Zeta_toxin [PF06414], Evalue: 6.50E-06, Aligned region: 448..517
Zeta_toxin [PF06414], Evalue: 6.50E-06, Aligned region: 614..655
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 236..261
AAA_19 [PF13245], Evalue: 1.10E-05, Aligned region: 613..637
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 239..336
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 614..705
AAA_17 [PF13207], Evalue: 2.20E-05, Aligned region: 239..304
AAA_17 [PF13207], Evalue: 2.20E-05, Aligned region: 614..651
AAA_17 [PF13207], Evalue: 2.20E-05, Aligned region: 798..816
Sigma54_activat [PF00158], Evalue: 8.10E-05, Aligned region: 220..253
Sigma54_activat [PF00158], Evalue: 8.10E-05, Aligned region: 615..732
Clp_N [PF02861], Evalue: 0.00075, Aligned region: 23..60
Clp_N [PF02861], Evalue: 0.00075, Aligned region: 111..125
Clp_N [PF02861], Evalue: 0.00075, Aligned region: 453..472
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 237..256
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 310..319
RuvB_N [PF05496], Evalue: 0.0019, Aligned region: 575..636
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 240..261
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 616..637
AAA_33 [PF13671], Evalue: 0.0024, Aligned region: 239..256
AAA_33 [PF13671], Evalue: 0.0024, Aligned region: 614..647
AAA_33 [PF13671], Evalue: 0.0024, Aligned region: 745..816
AAA_18 [PF13238], Evalue: 0.0026, Aligned region: 239..264
AAA_18 [PF13238], Evalue: 0.0026, Aligned region: 616..645
DUF258 [PF03193], Evalue: 0.0029, Aligned region: 221..257
DUF258 [PF03193], Evalue: 0.0029, Aligned region: 615..629
DUF258 [PF03193], Evalue: 0.0029, Aligned region: 791..834
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 239..261
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 614..660
Protein Sequence: 882 a.a.     [Download]
>gi|384121897|ref|YP_005504517.1| Clp ATPase [Yersinia pestis D106004]
MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLLEQGEGDITVIARRYEWDMDSLWQGL
LAYLDTLPRTVQGKPQLSAALQQLIKSAWLDASLQENADAVRSVHLMAALINSPSLLAADAAWPLLSLST
TQLHRLLPLLDSQSDERPEIQQAAALADSPVNLTDEAATVTSASGQPQLNDALQAALDKFTLDVTAKARA
NQIDPIFGRDSEIRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVSVRTLDLGL
LQAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAAT
TWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGVHILDAAITAAVTLSRRFLTGR
QLPDKAVDLLDTAGARVRMSIDTLPTALMAINAELAALAMEQQAIEQDLLLLPNVSSTRLPEIEQRRAAL
AVGQHTLEQQYKEEKRLTTLIIEARQDIANVAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGV
PLSSLLKDEQTDLLQLENHLATRVVGQDTALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETAL
ALADSLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDV
LNLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHLMQLLDEQPEATHSDLHELLRPILRDHFQPAL
LARFQTLIYRPLNAIALRTIVEMKLAQVAKRLNKHYGLHCTIEESLYDTLVAACLLPDTGARNIDSLLNQ
QILPVLSQQLLSRMSEQQRTTSLTLGWDEADGITLEFEGGEK
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|384120592|ref|NC_017154.1|:1674766-1677414 Yersinia pestis D106004 chromosome, complete genome
ATGACAACGCATTCAGCACACTTATTACGCCGCTTAAATCCCTATTGCGCACAGGCACTGGCCGGTGCTG
CCACCCTGTGTCAGACCCGCGCCCATGCCGAGATCACTGTCGAACACTGGTTGTTAAAACTGCTGGAGCA
GGGCGAAGGCGATATCACGGTGATTGCCCGGCGTTATGAGTGGGACATGGACAGCTTGTGGCAAGGGTTA
CTGGCCTATCTGGATACTTTGCCGCGCACGGTACAGGGTAAACCCCAACTGTCCGCCGCGTTGCAGCAAC
TGATCAAAAGTGCCTGGCTGGATGCCTCGTTGCAGGAAAATGCTGATGCGGTGCGCTCGGTTCATCTAAT
GGCAGCGCTGATAAATTCGCCATCATTATTGGCCGCCGATGCCGCCTGGCCGTTGCTCAGCCTGAGCACT
ACCCAACTACACCGCTTGTTGCCGTTGCTGGACAGCCAATCCGACGAACGCCCTGAAATACAGCAGGCCG
CAGCACTGGCAGACAGCCCGGTCAATCTGACCGATGAGGCCGCGACGGTTACCTCCGCCAGTGGTCAGCC
GCAACTGAATGACGCGCTGCAAGCGGCGCTGGATAAATTTACCCTCGATGTCACCGCCAAAGCCCGTGCC
AACCAGATTGATCCGATTTTTGGCCGCGACAGCGAAATCCGCCAGATGATCGACATCCTGTCGCGCCGCC
GTAAAAACAACCCGATTTTGGTGGGTGAACCGGGTGTGGGGAAAACCGCCTTGGTTGAAGGGCTGGCACT
GCGCATTGCCGAGGGCAACGTACCGGACAGCCTGAAAACCGTCAGTGTGCGCACACTGGATTTGGGTCTG
TTACAGGCCGGTGCCGGGGTCAAAGGCGAGTTCGAACAGCGCCTGAAAAATGTTATCGAGGCGGTGCAAC
AATCCCCCAGCCCGGTGCTGCTGTTTATCGACGAAGCCCACACCATTATCGGGGCCGGTAATCAGGCCGG
TGGTGCCGATGCGGCCAACCTGCTGAAACCGGCACTGGCGCGTGGCGAACTGCGCACCATCGCCGCCACC
ACCTGGTCCGAATACAAACAGTATTTTGAACGCGATGCCGCACTGGAGCGCCGCTTCCAGATGGTCAAAG
TGGACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGTGGCCTGAAAGAACGTTACGCCACCCATCA
CGGCGTGCATATTCTGGACGCCGCTATCACCGCAGCGGTTACCCTGTCGCGCCGCTTCCTGACCGGCCGC
CAACTGCCGGACAAAGCGGTGGATCTGCTCGATACCGCCGGTGCCCGGGTGCGCATGAGCATTGACACCT
TGCCGACTGCGCTGATGGCGATTAACGCCGAGCTGGCCGCACTGGCGATGGAGCAACAGGCCATCGAACA
GGACCTGCTCCTGCTGCCGAATGTCAGTTCAACGCGCTTACCTGAGATTGAGCAACGCCGCGCCGCGCTG
GCGGTTGGGCAGCACACACTCGAACAGCAATATAAAGAAGAAAAACGGCTGACCACCCTGATTATCGAGG
CGCGTCAGGATATCGCCAACGTGGCACATCTGGTCGCGTTGCAGGAGGAACTCGTTCAGATCCAAGGCAA
CGCGCCGCTGCTGTCGCTGGACGTTGATGTGCGCACTGTTGCGGCTGTGATCGCCGACTGGACCGGCGTG
CCGCTGAGCAGTCTGTTGAAAGACGAACAGACCGATTTGTTGCAACTGGAAAACCATCTCGCCACCCGCG
TAGTCGGGCAGGATACGGCGCTGGGTGCGCTGGCGCAACGGCTGCGGGCGGCGAAAACCGGGCTGACATC
AGAGAATGGCCCGCTGGGGGTGTTCCTGCTGGTCGGGCCGAGTGGGATCGGCAAAACCGAAACCGCGCTG
GCACTGGCCGACAGCCTGTTCGGCGGCGAGAAATCGCTGATCACCATCAACTTATCGGAGTATCAGGAAG
CTCACACCGTCTCCCAGTTGAAAGGGTCGCCCCCAGGTTATGTTGGCTACGGTCAGGGTGGTGTATTAAC
CGAAGCGGTACGTAAACGGCCTTACAGCGTGGTGCTGCTGGATGAAGTGGAAAAAGCCCATCGTGATGTG
CTGAACCTGTTCTATCAGGTGTTTGACCGGGGGTTCATGCGCGACGGTGAAGGGCGCGAAATTGATTTTC
GTAACACAGTGATCCTAATGACGGCCAATTTAGGCAGTGATCATCTGATGCAGTTACTGGATGAACAACC
GGAAGCGACGCACAGTGATTTACACGAGCTGCTGCGCCCGATCCTGCGCGATCATTTCCAGCCCGCGCTA
TTAGCCCGCTTCCAGACCTTGATCTACCGCCCACTGAATGCCATCGCATTGCGCACCATCGTCGAGATGA
AACTGGCACAGGTCGCTAAACGCCTGAACAAACATTACGGCCTGCACTGCACCATTGAGGAAAGCCTCTA
CGACACACTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCACGCAACATCGACAGCCTGCTCAATCAA
CAAATCTTACCGGTATTGAGCCAGCAGCTGTTAAGCCGCATGAGCGAGCAACAGCGCACCACCTCGCTGA
CGCTGGGCTGGGATGAAGCCGACGGCATTACCCTTGAATTTGAAGGAGGCGAAAAATGA