SecReT6
Protein ID: 384121907
SecReT6 ID570
T6SS typei2
Gene symbol-
Locus tagYPD4_1316
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]1697946..1699547 [+]
Producthypothetical protein
NoteTssA
UniProt IDD0JJC6
KEGG IDypd:YPD4_1316
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 69..126
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 157..182
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 302..315
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 354..364
Protein Sequence: 533 a.a.     [Download]
>gi|384121907|ref|YP_005504527.1| hypothetical protein YPD4_1316 [Yersinia pestis D106004]
MATLTTLLTACAAEPEPLLQQARQQVALWERWLQPVTPDKHTGEDPGYDDHFQQMREEVNKLSGADTTLT
CELAEKLFTTHGKDVRVATYYVWARLHRDGEAGLADGLSLLAGLITRFGEGLHPLRTTSRKTALEWLAGS
RMRDSLSLYPEVDKADFERIVGALALIEQRLSLWDEGVRPQLGGLYTALENRLAQSGGLNAVVPQNSSGS
SSAGSLNPANTASPALRPVQSGRDLLDQTKTLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVNGRT
RLVPPRPEYRVQLKRLYLQQNWLALLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWASCITQDL
RLLLTRLPGLEGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVSSGEDGILLLEPEALAQADSEG
IEAALNWLQSRPGITTARHQWLLRLVMARVAEQYGKNDMALHLLSGLDSSGALLTLPQWEPGLVFEVKAR
RLKLLRMKAQRGDSDKTRLHAEMESLLSGLIALDPARAAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|384120592|ref|NC_017154.1|:1697946-1699547 Yersinia pestis D106004 chromosome, complete genome
ATGGCGACGTTAACTACCTTGCTCACCGCTTGTGCCGCAGAGCCTGAGCCACTTTTACAGCAGGCCAGAC
AACAGGTTGCGCTCTGGGAACGTTGGTTGCAACCGGTGACACCCGATAAGCATACCGGTGAAGACCCCGG
TTACGATGACCACTTCCAACAGATGCGTGAAGAGGTCAATAAGCTCTCGGGTGCCGATACCACGCTGACC
TGCGAGCTGGCTGAAAAGCTGTTCACCACACACGGCAAGGATGTGCGGGTGGCAACCTATTACGTCTGGG
CGCGGTTGCACCGTGACGGCGAGGCCGGGCTGGCGGATGGCCTTTCCCTGCTGGCCGGGCTGATCACGCG
CTTTGGTGAGGGCCTGCATCCGCTGCGTACAACCAGCCGGAAAACCGCGTTGGAGTGGCTGGCCGGCTCC
CGGATGCGCGACAGCTTGTCACTTTACCCGGAAGTGGATAAAGCCGATTTTGAGCGTATCGTGGGCGCAC
TGGCCCTTATCGAACAGAGGCTCAGTCTCTGGGACGAAGGCGTCCGGCCGCAACTGGGCGGGTTGTATAC
CGCCCTGGAAAACCGCCTCGCGCAATCTGGTGGGCTAAATGCCGTGGTGCCGCAAAACAGCAGCGGGTCA
TCATCGGCAGGCAGCTTGAACCCAGCCAACACGGCGTCACCGGCGTTGCGGCCAGTGCAATCGGGACGTG
ACCTGCTCGATCAGACCAAAACGCTGGCAAAATACCTGCGCAACCAGCCGCAGGGCTGGCTCTCCGGGCA
TCATCTTATCAAAAGCGTGCGCTGGGATACGGTACATCAGTCACCGCCATTAGATGTGAACGGACGGACC
CGGCTGGTACCGCCGCGCCCGGAATATCGCGTACAACTCAAGCGCCTTTATCTGCAACAAAACTGGCTGG
CGTTGCTGGAACAGGCCGAATCGATATTTGCCGAAGGGGTTAACCATTTCTGGCTCGATGTGCAGTGGTA
TCTGCATCAGGCCCTCAGCAAAGCGGGGGCCCCATTCGATGGCTGGGCGAGCTGTATCACGCAGGATTTA
CGGTTATTACTGACCCGGCTGCCGGGGCTGGAAGGGCTATGCTGGAGTGACGGCACGCCATTTGCCGATG
AGGTGACGCTGGGGTGGATAAACCAGCAGGTACTGGAGTCGGTCTCGGGCTGGGGCAGCGAGCCGGCCGC
CGTTTCATCCGGTGAGGATGGCATTCTGTTGCTGGAGCCAGAAGCTTTGGCTCAGGCGGACAGCGAAGGA
ATTGAAGCGGCGCTTAACTGGTTGCAGTCACGACCGGGGATCACCACGGCGCGCCATCAGTGGCTGCTGC
GTCTGGTGATGGCCCGGGTGGCGGAGCAGTACGGTAAGAACGATATGGCCTTGCATCTGCTGAGTGGCCT
TGATAGCAGCGGCGCGTTGTTGACCTTGCCACAGTGGGAGCCGGGGTTGGTGTTTGAAGTTAAAGCCCGC
CGTTTGAAGCTGTTGCGTATGAAGGCACAGCGGGGTGACAGTGATAAAACCCGCCTGCATGCTGAAATGG
AAAGCCTGCTCAGTGGGCTTATCGCCCTCGACCCGGCCCGTGCGGCCGTATTATGCGGATAA

Protein ID: 384121914
SecReT6 ID570
T6SS typei2
Gene symbol-
Locus tagYPD4_1323
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]1705159..1706526 [+]
Producthypothetical protein
NoteTssA
UniProt IDD0JJD3
KEGG IDypd:YPD4_1323
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.20E-50, Aligned region: 116..150
DUF3702 [PF12486], Evalue: 3.20E-50, Aligned region: 303..448
ImpA-rel_N [PF06812], Evalue: 7.80E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 7.80E-20, Aligned region: 231..244
Protein Sequence: 455 a.a.     [Download]
>gi|384121914|ref|YP_005504534.1| hypothetical protein YPD4_1323 [Yersinia pestis D106004]
MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPDVDWVRVEQLCLALFRQNGVELQTAVDFTLART
HTVGLAGLCEGLELLAGLVCHQWRGLWPPQTHARVALLAWLSDRLQQVWRTMTLCYGDLAQVYRAERALE
QLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGLAKPRGASEPPESLRFASVPVSEPLVYIISE
PAPPPVQVVLPASPPRWKAGHGFAAGLSLMAVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIA
ELKKQASDVEWARLAEPVLQASAMQLDQLTQLPPLWAQARGDALLSQAQQLWPTNQEVKRLNALWQQQRA
AGAAPLVELKHYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|384120592|ref|NC_017154.1|:1705159-1706526 Yersinia pestis D106004 chromosome, complete genome
ATGGCAGGTAATACCGAGCGTCTGCTGAAAACCGGTGGCGATCCGCGCGCACTGGCGGATTTCACCGCAC
TGCGGGGTGAATTAAATAAACTGGCCCACCCGGCCCGCCCGGATGTTGATTGGGTGCGAGTCGAGCAGCT
TTGTTTGGCGCTGTTTCGCCAGAACGGCGTTGAGTTACAGACTGCCGTTGATTTTACCCTGGCACGAACG
CACACCGTTGGGTTGGCGGGCTTATGTGAAGGGCTGGAACTGTTGGCGGGGTTGGTCTGCCATCAATGGC
GTGGGTTATGGCCACCGCAAACGCATGCCCGGGTGGCGTTACTGGCCTGGTTGAGCGACCGGCTGCAGCA
AGTGTGGCGCACCATGACGCTGTGCTACGGTGACCTGGCGCAGGTGTACCGGGCAGAGCGGGCGCTGGAA
CAGTTGTGTACGCAGTTGCAAACGCTGGAGCTCAAACATTTGTGCAAGCTGGACGGGGTTCGTTTGATGC
TGCATAACGCGGCGCAGCGGTTGGAAAGTACCGAGGCCGTGTCTGGCCTTGCGAAACCACGGGGTGCCTC
TGAACCGCCCGAGTCGCTGCGATTTGCCTCTGTCCCGGTCAGTGAACCACTGGTGTATATTATCAGCGAA
CCGGCCCCGCCACCTGTTCAGGTGGTTTTACCTGCCTCACCTCCGCGCTGGAAGGCGGGCCACGGTTTTG
CCGCGGGGTTATCGTTGATGGCGGTACTGATGGCCGGCAGTTTCGTTATCTGGCAGTCGGTATCATCGGA
TCCCGTGAGGGAAACATTGCTGGCCACTGCCAGTCCTTTGCCGATACCGCTGAGTGCTAACTCAATAGCT
GAACTGAAAAAACAGGCTTCAGATGTTGAGTGGGCACGTCTGGCGGAACCGGTGTTGCAAGCCAGTGCGA
TGCAGTTAGATCAACTAACACAGTTACCGCCGTTATGGGCGCAGGCTCGGGGGGATGCCTTGCTATCTCA
GGCGCAACAACTGTGGCCGACCAATCAAGAGGTCAAACGACTGAATGCGTTGTGGCAGCAACAGCGAGCA
GCCGGTGCTGCGCCCTTGGTAGAGTTGAAACACTATGCATTGGCGCAAGACCGTTTGCGGCAACTGGCAG
AACGACTGAATAGTCTGGATGAGAAAAAACGCGGATATATGACGGTCTCCGAACTGAAATCTGCCGTCTT
TGCTATCCAACAGCCGCTGGCACAGGCCGTGCCACTGGAAGAACTGCTGCGGCAATATCAGGAACAATTA
GAATCAGGGCAAACTCCATCCTCAGCACTGCGTCAACAGATTGACAGCCGGTTTAGTCAATTGCTGAACC
GCTATGCGTTGCTGGTCGTACCTCCTGGCGTTCAGTAA