SecReT6
Protein ID: 384121908
SecReT6 ID570
T6SS typei2
Gene symbol-
Locus tagYPD4_1317
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]1699565..1700623 [+]
Producthypothetical protein
NotePAAR
UniProt IDD0JJC7
KEGG IDypd:YPD4_1317
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 6.20E-28, Aligned region: 194..303
PAAR_motif [PF05488], Evalue: 3.50E-10, Aligned region: 10..65
Protein Sequence: 352 a.a.     [Download]
>gi|384121908|ref|YP_005504528.1| hypothetical protein YPD4_1317 [Yersinia pestis D106004]
MAKGYYLGVGDETTCGGVIIEGDATHVLMGKAVAREQDRVTCGKHPGTYIIIGHVPGDSVNGRKFAGTLN
SQSNCPCKAWFIPSLVHDTYEFGARSKSQNMSEISTEVEREMVENVSESEEKSKVVCAHIDGALVVASYI
LDEIKKNVKSDTADKIRSFIDNDLYKKRLKEWQDSPWYARMNAPPQPEIISASVLWFMAVKSGAKWDHKP
KIRDQFKAYAVSRPLVGSGTRSKSYFHKYEEHDYFYDVWSNIHYGYVGLSLGFDESYLLLGSTLEQVRTS
IGSKPDPIDDITCMKIGYALYHQHGKYAETLDVRHILDALESASDLDLAISRQIHWCWNNDNSSQIDHPQ
GK
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|384120592|ref|NC_017154.1|:1699565-1700623 Yersinia pestis D106004 chromosome, complete genome
ATGGCAAAAGGCTATTACCTTGGGGTTGGGGATGAAACAACCTGCGGCGGCGTGATCATCGAAGGTGACG
CCACACATGTCTTGATGGGTAAAGCGGTGGCCCGTGAACAAGACAGAGTGACCTGCGGTAAACATCCGGG
AACCTATATTATTATCGGCCATGTTCCTGGCGATTCGGTAAATGGCCGCAAGTTTGCGGGCACCTTGAAT
AGTCAAAGCAATTGCCCGTGCAAGGCGTGGTTTATTCCTTCTTTGGTGCATGATACGTATGAGTTTGGTG
CAAGAAGTAAATCACAAAATATGTCTGAAATTAGTACTGAAGTCGAACGTGAGATGGTAGAAAATGTGAG
TGAATCAGAAGAAAAATCTAAAGTTGTCTGTGCCCATATTGATGGCGCTTTAGTAGTAGCGAGTTATATC
CTTGATGAAATAAAGAAAAATGTAAAAAGTGATACCGCTGATAAAATCAGATCTTTTATCGATAATGACC
TCTATAAAAAAAGACTTAAGGAGTGGCAGGATTCTCCTTGGTACGCGAGAATGAATGCACCTCCACAGCC
TGAAATAATATCGGCATCGGTTTTATGGTTTATGGCGGTCAAGAGTGGTGCTAAATGGGATCATAAACCT
AAAATTAGAGATCAATTTAAAGCATATGCAGTTTCTCGTCCTCTGGTCGGAAGCGGAACCCGATCAAAAA
GCTATTTTCATAAATATGAAGAACATGATTATTTTTATGATGTCTGGTCCAATATTCACTATGGTTATGT
AGGCTTAAGTCTTGGTTTTGATGAGTCATATTTATTACTTGGCTCAACTCTTGAGCAAGTAAGAACCAGC
ATCGGGAGTAAACCAGATCCTATAGATGATATTACATGTATGAAAATTGGCTATGCACTCTATCATCAAC
ATGGAAAATATGCTGAGACGTTAGATGTCAGGCATATACTCGATGCTCTTGAATCAGCATCGGACCTTGA
TCTAGCTATTTCAAGACAAATTCATTGGTGTTGGAATAATGATAATTCGAGTCAAATTGATCACCCGCAG
GGTAAGTAA