SecReT6
Protein ID: 384121913
SecReT6 ID570
T6SS typei2
Gene symbol-
Locus tagYPD4_1322
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]1704682..1705134 [+]
Producthypothetical protein
NoteTssE
UniProt IDD0JJD2
KEGG IDypd:YPD4_1322
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-14, Aligned region: 31..116
Protein Sequence: 150 a.a.     [Download]
>gi|384121913|ref|YP_005504533.1| hypothetical protein YPD4_1322 [Yersinia pestis D106004]
MPDTSSPSLYEQLLGNFTGGLDLHQVSDENQVILSVLDNMQRILNCRAGTLSHLPDYGLPDMSKILQGLP
GSAHSLLTTLSATLLKYEPRLKSLQVILLPQTTPGHLEYAIDAELKGLGLVRYGTAFMPEGRVLMRHLKQ
QHYLNQRESF
 
Nucleotide Sequence: 453 bp     [Download]
>gi|384120592|ref|NC_017154.1|:1704682-1705134 Yersinia pestis D106004 chromosome, complete genome
ATGCCGGATACCTCCTCGCCGTCACTGTATGAGCAATTGCTGGGCAATTTCACCGGCGGGCTTGACCTGC
ATCAGGTCAGTGACGAAAACCAGGTCATTCTCTCGGTGCTGGACAATATGCAGCGCATTCTTAATTGTCG
GGCCGGAACACTCAGTCATCTGCCCGATTATGGCCTGCCGGACATGAGTAAAATTCTGCAGGGGTTGCCG
GGCAGCGCGCATTCGCTGCTGACCACGCTGTCCGCCACCTTGCTGAAGTACGAGCCGCGTCTGAAAAGTT
TGCAGGTGATTCTGTTGCCACAGACCACACCCGGTCATCTGGAATACGCCATTGATGCGGAGCTGAAAGG
GCTGGGACTGGTGCGCTATGGCACGGCGTTTATGCCGGAGGGCCGGGTGCTGATGCGCCACCTTAAACAA
CAACACTACCTCAATCAGCGGGAGTCATTTTGA