SecReT6
Protein ID: 384123659
SecReT6 ID572
T6SS typeN/A
Gene symbol-
Locus tagYPD4_3072
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3893115..3893759 [+]
Producthypothetical protein
NoteTssF
UniProt IDD0JHI6
KEGG IDypd:YPD4_3072
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.50E-66, Aligned region: 7..214
Protein Sequence: 214 a.a.     [Download]
>gi|384123659|ref|YP_005506279.1| hypothetical protein YPD4_3072 [Yersinia pestis D106004]
MKNSLFRKGFEHYISFVRSDESKLVLAEENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRP
SVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPID
RLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQTGQ
HALM
 
Nucleotide Sequence: 645 bp     [Download]
>gi|384120592|ref|NC_017154.1|:3893115-3893759 Yersinia pestis D106004 chromosome, complete genome
GTGAAAAATTCATTATTCCGTAAGGGATTCGAACACTACATTTCCTTTGTTCGCAGTGATGAATCGAAGC
TGGTGCTTGCTGAAGAGAATGTCTCGGTCAGCCTGACGTGCACCAACCGTGAGTTGCCGCTGTCGTTGCG
CGTTGGTGATATCAATCAACTCAGCACAGACAGCCCTTCATTCGCGACGTTCCGCAATATTACCCGTCCT
TCCGTGCCGTTGTATCCGGTGCTGGATGGGGGCCTGCATTGGTCATTGCTCTCCAATATGTCGTTGAACT
ACATGTCCTTACTGGATAAGGACGCGTTGAAGCAAATTCTGCATACCTATGATTTCCCAAGCCTGCATAA
CCGGCAATCAGCCAGGGCATCGCAAAAGAAACTGGACGCTATCCAACGTATTGAAACACAACCGATTGAC
CGGTTGTTTCGTGGCTTACCTGTCAGAGGGCTACAAACCACGCTATGGCTGGAGCAAGGCGCTTTTAGCT
CTGAAGGCGAGCTTTATCTCTTCAGCACGGTATTAGCTCGCTTCTTCTCACTGTATGCCAGCGTCAATGC
GTTTCATCTTTTAAAAGTCATCAATCTTGATAATCAGGAATGTTACGAATGGCCGGTACAGACAGGTCAA
CATGCACTGATGTAA