SecReT6
Protein ID: 384123663
SecReT6 ID572
T6SS typeN/A
Gene symbol-
Locus tagYPD4_3076
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3896801..3898147 [+]
Producthypothetical protein
NoteTssK
UniProt IDD0JHW8
KEGG IDypd:YPD4_3076
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-155, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|384123663|ref|YP_005506283.1| hypothetical protein YPD4_3076 [Yersinia pestis D106004]
MPTKNRVIWREGLFIKPQHFQQQQRHNDYQLQRRIIALQGYSYGFSSLILNQELLKLGRIGLTVASGNMA
DGTVFDIPYQDYSPKPLDVLNCNDAASRDIYLALPMLNDAINEVAGQQGQAPGTLRYREHSDDVRDLHTE
GGDVSQLVLAQLAPRLMQGSEDLSAYSVLPLCRVKEKRPDGSLILDEEFIPTCTTLSVSTQLKGFMDEVE
GTLVERAQLLAKRIGSPGQQGIADVAEFMMLQVFNRTQPLFTHLAHQAILHPEAFYHQLVQTCGELRTFT
DESRLAGTFPVYNHDNLTDSFQPLFLAMRQALSTVLTPRAISIQLHMQAHGIRVATINDSDLLRSADFVL
AVRAQIPQEQLRRQFVQQTKITSLEKIRDLVSVQLPGVPLVALSAAPRQLPYHSGYTYFMLDLQSPVWKE
IQQSNAIAFHVSGDFPDLDMQFWAIRSS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|384120592|ref|NC_017154.1|:3896801-3898147 Yersinia pestis D106004 chromosome, complete genome
ATGCCAACCAAAAATCGAGTGATTTGGCGCGAAGGGCTGTTCATCAAACCGCAACATTTTCAACAACAGC
AACGGCATAACGACTACCAGTTACAACGCCGGATTATCGCTCTGCAAGGGTATAGCTATGGTTTCAGTTC
ACTGATCCTGAATCAGGAGTTATTGAAATTAGGGCGTATTGGCTTGACGGTCGCCAGTGGCAATATGGCT
GATGGCACGGTGTTTGATATCCCTTATCAAGACTATTCACCAAAGCCATTGGATGTACTGAATTGTAATG
ATGCGGCCAGCCGTGACATTTATCTGGCATTACCGATGCTAAACGATGCCATTAATGAGGTGGCAGGCCA
GCAGGGGCAAGCGCCGGGAACCCTTCGCTATCGTGAACATAGCGATGATGTCCGCGATTTACATACCGAA
GGGGGCGATGTCAGCCAGTTGGTACTGGCACAACTGGCACCGCGTTTGATGCAAGGCTCGGAAGACCTCA
GTGCTTACTCGGTCCTGCCGCTGTGTCGGGTCAAAGAGAAACGGCCTGACGGTTCGCTGATCTTGGATGA
AGAGTTCATTCCCACCTGCACCACGCTCAGTGTCTCCACGCAGTTAAAAGGCTTTATGGATGAAGTCGAA
GGGACATTGGTTGAACGCGCCCAACTACTGGCGAAACGTATTGGTTCTCCCGGTCAGCAGGGGATCGCGG
ATGTGGCTGAATTTATGATGTTGCAGGTCTTTAACCGGACACAGCCGCTCTTTACCCATTTGGCACATCA
GGCGATTCTGCATCCAGAAGCGTTTTACCATCAGTTGGTACAAACCTGCGGTGAACTGCGCACGTTTACC
GATGAATCACGCTTAGCGGGCACCTTCCCGGTTTATAACCACGATAACTTGACCGACAGTTTTCAGCCGT
TGTTTTTGGCGATGCGTCAGGCATTAAGCACCGTGCTCACACCGCGTGCCATCTCTATCCAGTTGCATAT
GCAGGCACACGGTATTCGCGTTGCGACCATTAATGATAGTGATCTATTGCGCAGTGCTGATTTTGTGCTG
GCGGTTCGGGCGCAAATACCTCAAGAACAATTGCGTCGGCAGTTTGTTCAGCAAACCAAAATCACCTCAC
TTGAGAAAATACGCGATTTGGTCAGTGTCCAACTGCCCGGCGTCCCGTTGGTGGCACTGTCCGCCGCACC
GCGCCAGCTCCCTTACCACTCGGGATACACCTACTTCATGCTGGATCTGCAAAGCCCTGTATGGAAAGAA
ATCCAGCAAAGCAATGCGATTGCCTTCCACGTCTCGGGTGATTTCCCTGATCTGGACATGCAATTCTGGG
CAATCAGGAGCAGCTAA