SecReT6
Protein ID: 384123672
SecReT6 ID572
T6SS typeN/A
Gene symbol-
Locus tagYPD4_3085
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3909423..3911825 [+]
Productputative Rhs accessory genetic element
NoteTssI
UniProt IDD0JHX7
KEGG IDypd:YPD4_3085
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 194..491
Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 670..701
Phage_base_V [PF04717], Evalue: 1.90E-23, Aligned region: 531..623
Protein Sequence: 800 a.a.     [Download]
>gi|384123672|ref|YP_005506292.1| putative Rhs accessory genetic element [Yersinia pestis D106004]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALEAKAKVLDGGVT
PMNLAAGGAGAGLPDSAAAAISRLVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASAD
PAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQAS
VEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDV
GSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAWQLLGIQHSGK
QMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWD
RYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKT
QMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSN
TIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNA
GITITHDGAIVLQGKYIRLAADMIDLNPEE
 
Nucleotide Sequence: 2403 bp     [Download]
>gi|384120592|ref|NC_017154.1|:3909423-3911825 Yersinia pestis D106004 chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCAAAAACCGCCCTGGATGCC
AAAGCAAAAGTACTGGACGGCGGCGTCACGCCGACGAACATTGTGGCCACTGGCCCGGCCCCAACCGTGA
GTGGCGCTCAAATGACCGAGATGGCCGGGGGGATCGGGGATGCGGTGGGCGGTACTGCCGGTAAGCGCAT
TAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGAGGCCAAAGCAAAAGTACTGGACGGCGGCGTCACG
CCGATGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTGCCGGACAGCGCCGCGGCGGCGATATCCCGCC
TGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGACGGCCAGTTTACCGCCCCAGACCTTTGCGGT
GGTGGATTTCACCCTGAGCGAGATGCTCTCCTCGCCGTTTGTGCTCAATGTCGGGCTGGCGAGTGCCGAT
CCGGCGGTGGATTTTGCGGCGGTATTGGATGAAGACGCCACGCTGTTTATCTGGCGCGAAGGGGTACTGC
AACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGGCGATACCGGTTTTCATCAGACCCGCTACAG
CATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGGCGCAATGCCCGCATCTTCCAGCAAGCCTCG
GTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCATCAACGATTTTGCTTTTGGTTTTCGCCACC
CGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTCCGATTTTGATTTTATCCAGCGCCTGACGGC
AGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGGAAAAATACCGTGGTGTATGCCGATGATGTT
GGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGAATGTGGCGGCGCAGGCGCAGGAACTGAGTA
TCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGATGGTGCAACTGAAAGACTACACCTTTAAAAA
CCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAACTGCAAAACCAGCGACCGGACTACGAGCAT
TTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGCAGGATTTTACCCGCTACCGGCTGGACGCGC
TGCGCAATGACGCCAATCTGGGGCAGGGGGCCAGCAATGATTTTACCCTCCAGCCGGGGCAGTTGTTCAG
CCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGGCAGTTGCTCGGTATTCAGCACAGCGGCAAA
CAGATGCAGGCGCTGGAGCAGGCATCTGGCGATCAGGGCACGGTGCTGTTCAACCACTTCAGTTTTATTC
CGCACACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACCGGCGATGGACGGCCCGCAGATCGCCATGGT
GGTGGGGCCGCCGGGGGAAGAGATTTACTGCGACGAATACGGCCGCATCCGCCTGCAATTTTTATGGGAT
CGCTACGGGCAGAGCAATGACAACAGCTCCTGTTGGATCCGGGTAACCCAGCCGTGGGCGGGCCAGGGCT
GGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGTGGTGGATTTTCTGCACGGCGATCCGGATCA
ACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATCCCGCCGGGGTCGTTACCGGCCAGTAAAACC
CAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCTACAACGAAATGCGCTTCGAGGATGCCAAAG
GCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGACGACCATGGTGCTGAATGATCGCAAAACCGA
TGTGACTCAGGACCATTCAGAGCACATTGGGCAAGATCAGTCCGTGACGGTTGTGCGTAACCAAAGTAAT
ACGATCCAAAATGATCGCCGGGTAGAGGTGACTCGCGATCAACAAACCGAAGTGGGCAATGATTACCAGC
TAGTGGTGAAAGGTGAAAAGAAAGAGTTTGTGACGAAAATTCGTTACACCGAAGTGCATGAAGACGAAAC
GCTCACGGTGACGAAAAGTATTAAAATCCATGCCAAACAAGGTGATATCAGCATATCAACCCCGAATGCC
GGAATTACGATCACCCATGACGGTGCCATTGTTCTGCAAGGGAAATACATTCGTTTAGCGGCCGATATGA
TCGATCTTAATCCAGAGGAGTAG