SecReT6
Protein ID: 384123678
SecReT6 ID572
T6SS typeN/A
Gene symbolvgrG6
Locus tagYPD4_3091
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3918422..3920620 [+]
Productputative Rhs accessory genetic element
NoteTssI
UniProt IDD0JHY3
KEGG IDypd:YPD4_3091
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-70, Aligned region: 134..431
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 471..563
Gp5_C [PF06715], Evalue: 1.30E-05, Aligned region: 605..628
Gp5_C [PF06715], Evalue: 1.30E-05, Aligned region: 630..654
Protein Sequence: 732 a.a.     [Download]
>gi|384123678|ref|YP_005506298.1| putative Rhs accessory genetic element [Yersinia pestis D106004]
MFAHDKANNNKTADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPF
VLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLR
RNARIFQQASVEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAG
KNTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGE
LQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGVQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEY
GRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNI
PPGSLPASKTQMAFRSKTHQGEGYNEMRFEDAKGGEGLFMHAQKDMSTTVKDNQTTTVEKGNQTVTVEKG
DRTVTVATGNETTDITQGSLTETIKVRRSTCANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDS
IILQFSGSTSITLNAANIDAIAPLINLNKDKG
 
Nucleotide Sequence: 2199 bp     [Download]
>gi|384120592|ref|NC_017154.1|:3918422-3920620 Yersinia pestis D106004 chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAACCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATTAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGATGCC
AAAGCAAAAGTCCTGGACGGCGGCGTCACGCCGCTGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTAC
CGGACAGCGCCGCGGCGGCGCTTACCCGCCTGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGAC
GGCCAGTTTACCGCCCCAGACCTTTGCGGTGGTGGATTTCACCCTGAGTGAGATGCTCTCCTCGCCGTTT
GTGCTCAATGTCGGGCTGGCGAGTGCCGATCCGGCGGTGGATTTTGCGGCGGTGCTGGATGAAGACGCCA
CGCTGTTTATCTGGCGCGAAGGGGTGCTGCAACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGG
CGATACCGGTTTTCATCAGACCCGCTACAGCATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGG
CGCAATGCCCGCATCTTCCAGCAGGCCTCGGTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCA
TCAACGATTTTGCCTTTGGTTTTCGCCACCCGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTC
CGATTTTGATTTTATCCAGCGCCTGACGGCAGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGG
AAAAATACCGTGGTGTATGCCGATGATGTCGGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGA
ATGTGGCGGCGCAGGCGCAGGAACTGAGTATCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGAT
GGTGCAACTGAAGGACTACACCTTTAAAAACCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAA
CTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGC
AGGATTTTACCCGCTACCGGCTGGATGCACTGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGA
TTTTACCCTCCAGCCGGGGCAGTTGTTCAGCCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGG
CAGTTGCTCGGCGTTCAGCACAGCGGCAAACAGATGCAGGCGCTGGAGCAGGCGTCTGGCGATCAGGGCA
CGGTGCTGTTCAACCACTTCAGTTTTATTCCGCACACCCAGACCTGGCGGCCGACGCCGCTGGCGAAACC
GGCGATGGACGGCCCGCAGATCGCCATGGTGGTGGGGCCACCGGGGGAAGAGATTTACTGCGACGAATAC
GGGCGCATCCGCCTGCAATTTTTATGGGATCGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCC
GGGTAACCCAGCCGTGGGCGGGCCAGGGCTGGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGT
GGTGGATTTTCTGCACGGCGATCCGGATCAACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATC
CCGCCGGGGTCGTTACCGGCCAGTAAAACCCAGATGGCGTTCCGCTCAAAAACCCACCAAGGGGAAGGCT
ACAACGAAATGCGCTTCGAGGATGCCAAAGGCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGAG
TACCACGGTAAAAGATAACCAGACGACGACGGTGGAGAAAGGTAATCAAACCGTCACCGTAGAAAAAGGT
GACAGGACAGTCACGGTCGCGACCGGAAATGAAACCACAGATATTACCCAAGGGAGCCTGACCGAGACGA
TCAAAGTGCGTCGCAGTACCTGCGCGAATTTTATTCAGGTGAAGGCTGAAGGTGATGCGCCTGGTACGCA
ACTTTATACCGCGACGGAACAGATAAAGTTCGTGGTGGGCAAGAGCAGCATTACCTTAAATCCGGACTCT
ATTATTCTGCAATTTTCTGGCTCTACCTCTATTACGCTGAATGCCGCCAATATTGACGCCATCGCGCCAT
TGATTAACTTAAATAAAGACAAGGGATAA