SecReT6
Protein ID: 384123846
SecReT6 ID800
T6SS typei1
Gene symbol-
Locus tagYPD4_3259
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]4125829..4126227 [-]
Producthypothetical protein
NoteTssE
UniProt IDD0JIT4
KEGG IDypd:YPD4_3259
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.80E-20, Aligned region: 18..108
Protein Sequence: 132 a.a.     [Download]
>gi|384123846|ref|YP_005506466.1| hypothetical protein YPD4_3259 [Yersinia pestis D106004]
MFDRIQGKGASSSSDGRLRELLNSIQKHLNEVLNSRPGACQSAVDLGVIDLNDATATSSDFRKSIEKAIK
DCIENYEPRISAVTVQSLLNHGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRYCFNQET
 
Nucleotide Sequence: 399 bp     [Download]
>gi|384120592|ref|NC_017154.1|:c4126227-4125829 Yersinia pestis D106004 chromosome, complete genome
TTGTTTGACCGCATACAGGGGAAGGGCGCTAGCTCTTCCTCCGATGGCCGTCTGCGTGAGCTATTGAATT
CAATCCAAAAGCATTTGAACGAGGTCCTTAACTCTCGTCCAGGTGCTTGCCAAAGTGCGGTCGATCTCGG
GGTTATCGACCTCAATGATGCGACCGCCACCTCATCTGATTTTCGAAAAAGTATTGAGAAAGCCATTAAG
GATTGTATCGAGAACTACGAACCCCGAATTTCTGCCGTTACAGTTCAATCCTTGCTGAACCATGGCGACC
CACTGCAACTGAGTTTCCATATTAGCGCTCGTGTTAATTTCGACGATATGGGTGATGTCGTTGAGTTCAA
CATTCAGTTAGACAATAACCGCCGTTACTGCTTTAACCAGGAAACATAA