SecReT6
Protein ID: 384124911
SecReT6 ID573
T6SS typei3
Gene symbol-
Locus tagYPD8_0442
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]534861..536705 [+]
Producthypothetical protein
NoteTssF
UniProt IDD0JNQ4
KEGG IDypx:YPD8_0442
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-143, Aligned region: 6..609
Protein Sequence: 614 a.a.     [Download]
>gi|384124911|ref|YP_005507525.1| hypothetical protein YPD8_0442 [Yersinia pestis D182038]
MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDPFVERLLEGTAFLSSRIQQRLNNEHP
EFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQWHSRVVLPKGSRVTLSDSSLNNRLANFSTGRTLKIQ
PLVIENAECASTPPAYLPLSVASQLQAGQAHLRLRLTTQGVASLSELDFAPMNLTLAGGIIQSNQLITTL
LNNTLHIVLWANTDGKPLVKVLTKEHLRQGGLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGL
NDFLQQGDGIHTFEVLFVLDQRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHTEYPVIVDPLN
PRLYEVHHVLGVNGLLSEGGSVQFSSLHGHARFDDDDKMAGYSIRRRRDFTDKNHQKNSPLPHDSLFIAL
SPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKLEIALPVGQIEMLRHPAKPQGVPNIDQAWRALQ
LIANNPLRYALPDVTDCSPLLKDWLSIFCQHEEASQHKRITSLTHASVAHNFERHTAPGPIAWSRGVEAT
LDFNSSHHSDKGAFLFARILHHALSEYCELGQTLRLHMQVDGETFAKWGPVNYG
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|384124469|ref|NC_017160.1|:534861-536705 Yersinia pestis D182038 chromosome, complete genome
ATGCCCAACGAAAGTTTTCTGGCTCTATACAACGAAGAGTTGCGTTATCTGCGTGAAGATGGGCAGCGCT
TCGCTCATATGCATCCGCAAGTCGCCCAACACCTTGGGTTACATGCTGATGGTGTGCTCGATCCTTTCGT
CGAACGGCTCCTTGAAGGCACCGCTTTCTTGAGTTCCCGTATCCAACAGCGTTTGAACAACGAGCATCCA
GAGTTTGCTTTGCAAATGCTTGGGCGTTTGGCCCCACTTTGGTATACACCCCTGCCGTCGATTGCCACCA
TTGCCATGGTTCCGGATCTTACGTCACCGCAATGGCACTCGCGCGTCGTATTGCCTAAAGGTAGCCGCGT
GACATTGAGTGACAGTTCGCTGAACAACCGGTTGGCGAATTTCTCTACTGGCCGCACGCTGAAAATACAG
CCATTGGTCATTGAAAATGCCGAGTGTGCCAGCACGCCACCGGCGTATTTACCGCTCTCTGTGGCTTCAC
AATTACAAGCTGGTCAGGCCCATCTGCGCTTGCGTCTGACCACTCAAGGTGTCGCGTCTTTATCTGAGCT
GGATTTCGCCCCGATGAACCTGACGCTAGCGGGGGGAATAATTCAGTCAAATCAGTTAATCACGACACTG
TTGAATAACACCTTACATATTGTTTTGTGGGCCAACACGGATGGGAAACCGCTGGTCAAAGTTCTTACCA
AAGAACATCTTCGCCAGGGAGGGCTGGATGAACAAGAGGCGCTTTTACCTGTTGCGATCAGCGAAATGCC
TGGAAACCGTTTGCTACGAGAATATTTTGCTGCTCCTTCGCGTTTTTTCGATCTGGAACTGCATGGCCTC
AACGACTTCCTGCAACAAGGGGACGGCATTCATACCTTTGAGGTGCTGTTTGTACTGGATCAGCGCCCCC
TACATTTGATTGATAGGGTCACTGGCAATGACTTCCGACTCTTCGCCACACCTATTATTAACCTGTTCAA
ACGCCGTTGTAGCCCGGTGCTGATTAATGGTGAACACACCGAATATCCCGTCATTGTTGACCCCCTGAAC
CCCCGCTTGTACGAAGTCCATCATGTACTCGGGGTCAACGGTTTGTTGAGCGAAGGGGGGAGCGTGCAGT
TTTCTTCCCTTCATGGTCATGCCCGTTTTGATGATGACGATAAAATGGCGGGTTACAGCATTCGCCGTCG
CCGCGACTTCACGGATAAAAATCATCAGAAAAATTCACCTTTACCTCATGACAGCTTATTCATTGCCCTT
TCACCGGGGACCAGCGGGATAGATATTGATCACGTCAAGTCGCTGTCGATTGAAGCCATGGTGTGCGAAC
GCCACTTAATTCCCAGCCAATTACAGCATCCGGAATTCAAGCTGGAAATTGCCCTGCCAGTGGGGCAGAT
CGAAATGCTGCGTCACCCGGCAAAACCACAGGGTGTGCCGAATATTGATCAAGCCTGGCGGGCGTTACAA
CTGATTGCCAACAATCCGCTGCGTTATGCGCTGCCGGATGTCACCGATTGTTCGCCGCTGCTAAAAGATT
GGCTGTCGATATTTTGTCAGCATGAAGAGGCGAGCCAGCATAAGAGGATCACTAGCCTGACTCACGCCAG
TGTGGCGCATAATTTTGAACGTCATACCGCTCCGGGGCCGATCGCCTGGAGCCGGGGGGTTGAAGCCACA
CTGGATTTCAACAGCAGCCACCACAGTGATAAAGGTGCATTCCTCTTTGCGCGGATCCTGCATCACGCGC
TGTCAGAATATTGTGAATTAGGGCAGACCCTGAGGTTACACATGCAGGTTGATGGTGAAACCTTCGCCAA
ATGGGGGCCTGTCAACTATGGCTAG