SecReT6
Protein ID: 384124912
SecReT6 ID573
T6SS typei3
Gene symbol-
Locus tagYPD8_0443
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]536698..537681 [+]
Producthypothetical protein
NoteTssG
UniProt IDD0JNQ5
KEGG IDypx:YPD8_0443
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-66, Aligned region: 18..312
Protein Sequence: 327 a.a.     [Download]
>gi|384124912|ref|YP_005507526.1| hypothetical protein YPD8_0443 [Yersinia pestis D182038]
MASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRSHLRLRIIQPADMGFAPREVSDIRQT
LNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHARNEALAKRNQAFEHFAGILSQRMAILHYRSWAQMHV
AVGHDRASANPFMNHVRQIAGLTPQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEILSLYFSVPIRVEAR
KGLWIDDSRNIESQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHDFVRH
RMVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT
 
Nucleotide Sequence: 984 bp     [Download]
>gi|384124469|ref|NC_017160.1|:536698-537681 Yersinia pestis D182038 chromosome, complete genome
ATGGCTAGCCTCCAGACGCTGAAAAACACGTTTCTGCCGGGTATCTCGGCCAGTCAGGACTTTTTCGAGT
TGCTGCGTCGCATTGAGCGTGCCACTCCAGAGCAAGGCCGGCTTGGCACCCAACGTGATCGTAGCCATCT
GCGGCTACGTATTATTCAGCCTGCCGATATGGGATTTGCACCGCGTGAAGTGAGTGATATCAGGCAAACG
CTGAACACTCATCAGCATCTGGCAGAGATCACCATTTTCTGCCGCCATTTTGGTTTATTTGCCCCGTATG
GCCCGTTGCCAATACATGTTACCGAACATGCTCGTAACGAAGCGTTGGCTAAACGTAATCAGGCCTTTGA
ACATTTTGCGGGCATTCTCAGCCAGCGAATGGCGATCTTGCATTATCGCTCTTGGGCCCAAATGCACGTC
GCCGTGGGGCATGATCGCGCGTCAGCCAATCCCTTTATGAACCATGTGCGTCAAATCGCGGGCCTAACGC
CGCAGCAAGCGCTGAATTCACATGTGGATCGGGTACGGCGTTGCTTTCCGGGGGTGTATCTGCCGGGCAG
AGGATCATTACGCAAATTACAGGAGATCCTGAGCCTGTATTTCTCGGTTCCTATCCGTGTTGAAGCCCGT
AAAGGATTGTGGATTGACGACTCGCGCAATATAGAAAGCCAACGTATGGGACGGTTGGGTAACACGCGTA
TTGGCAGCCGTTTCTTCGATGTGCAGCACAGCCTGGTGTTATCTATTGGTCCGGTATCTGACCCCCAATA
TCTGGATTTTCAACGCAACAGCAAACGCATTAACACTCTGGTGCAAATCTGCCATGACTTTGTCCGCCAT
CGGATGGTGCTGGACGTGCAATTAATCATACAGACCTCACCCAATATGGCTTGTCGTCTTGGCGGTGGAA
CGCTCAGTCGCCATAGCTGGTTAAAGCCAGGCTCAGCCTTGAGTATACAGCCAATTTATAGAACGGTTAC
CTAG