SecReT6
Protein ID: 384124919
SecReT6 ID573
T6SS typei3
Gene symbol-
Locus tagYPD8_0450
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]546717..547082 [+]
Producthypothetical protein
NotePAAR
UniProt IDD0JNR2
KEGG IDypx:YPD8_0450
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.70E-20, Aligned region: 18..107
PAAR_motif [PF05488], Evalue: 0.0028, Aligned region: 66..120
Protein Sequence: 121 a.a.     [Download]
>gi|384124919|ref|YP_005507533.1| hypothetical protein YPD8_0450 [Yersinia pestis D182038]
MTAANTRAGGISFIGSDPMIPISAPNTAPNANGIPNVSNYFCCGGNEQNLNTIRPATIDGGSVMGAASGT
HSAKMDPMQGSGKYFIQGSPATRLGDMSMTNNYNAPSTQIAPSQTKYFVNA
 
Nucleotide Sequence: 366 bp     [Download]
>gi|384124469|ref|NC_017160.1|:546717-547082 Yersinia pestis D182038 chromosome, complete genome
ATGACAGCAGCCAATACTCGCGCAGGTGGGATCAGCTTTATCGGCAGTGACCCGATGATCCCGATATCTG
CTCCCAACACCGCGCCCAACGCCAATGGTATTCCTAATGTCAGCAACTATTTTTGCTGTGGGGGTAACGA
ACAGAATCTCAACACCATCCGTCCAGCCACGATAGACGGCGGATCTGTGATGGGGGCGGCCTCGGGGACA
CATTCGGCCAAGATGGACCCTATGCAGGGATCAGGAAAGTATTTCATTCAGGGAAGCCCAGCAACACGTT
TAGGAGATATGAGTATGACCAATAATTACAACGCGCCTTCGACGCAAATTGCGCCCAGCCAGACCAAGTA
TTTTGTCAATGCGTAG