SecReT6
Protein ID: 384124920
SecReT6 ID573
T6SS typei3
Gene symbol-
Locus tagYPD8_0451
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]547093..547566 [+]
Productlipoprotein
NoteTssJ
UniProt IDD0JNR3
KEGG IDypx:YPD8_0451
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-17, Aligned region: 10..149
Protein Sequence: 157 a.a.     [Download]
>gi|384124920|ref|YP_005507534.1| lipoprotein [Yersinia pestis D182038]
MLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLKVCIIELNKEGWSPPGL
YQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLTLKSDARADFN
RVVLVDGKALSLKASTK
 
Nucleotide Sequence: 474 bp     [Download]
>gi|384124469|ref|NC_017160.1|:547093-547566 Yersinia pestis D182038 chromosome, complete genome
GTGTTGCCTATTTTTATCCTGACAGGTTGCGTCCTGCTCAGCGGCTGTAGCTGGTTTTCCTCATCCTCAG
AAGCGGCGCTACAGAAACGGCGGATTGACTTGCAGGTTGTTGCGGCTCCTCTCATCAATCCTGGGCCCAA
CGGTCAGGCACAGCCCTTGAAGGTATGCATTATTGAGCTGAATAAAGAGGGGTGGTCACCCCCCGGTTTG
TATCAGGGGACGCTCTGCAGTGGCATCAGTGTAGGAGGTGAAGTCGTCAGCGTGACGGAATACATCCTTG
CGCCGACAGAGGTGCGTCAATATTCCCGCGATGTTCCCTTTGAACAAGAGCGCTGGTGGGCAATAGCGGC
TGAGTTTCAGGAGATGAGTAACGGTAAAAGCCTATTAACGCTGAAATCTGATGCCCGTGCGGACTTCAAC
CGTGTGGTGCTCGTTGATGGTAAGGCCCTGTCATTAAAAGCGTCAACAAAGTAG