SecReT6
Protein ID: 384124921
SecReT6 ID573
T6SS typei3
Gene symbol-
Locus tagYPD8_0452
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]547668..550631 [+]
ProductOmpA domain-containing protein
NoteTssK
UniProt IDD0JNR4
KEGG IDypx:YPD8_0452
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.10E-121, Aligned region: 19..446
DUF2077 [PF09850], Evalue: 2.70E-44, Aligned region: 282..314
DUF2077 [PF09850], Evalue: 2.70E-44, Aligned region: 594..789
OmpA [PF00691], Evalue: 3.00E-12, Aligned region: 849..952
Protein Sequence: 987 a.a.     [Download]
>gi|384124921|ref|YP_005507535.1| OmpA domain-containing protein [Yersinia pestis D182038]
MLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGFHSLSINQGLLDQGKIALNQASGVFP
DGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLMDIPGNTYIDLKKSNQGSRFVALDAEVQDRNHGVAAE
GTPLIATLQLGQLQSKLTLRASVSDAESMLPVAYIKERTRDGRLILDDNFLPPMLDFRAIGWIDNAVTEL
LGLIVQRLESVYRPDVTLSVGGLSELLELLLLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLLGRLSTI
PGGEKPWSRQDLLYTHHEPHNGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQNDSQLRLEKLIF
TVSSKLPSETIRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRYIPYYPNSVYFEVDHDDPMYKE
MMSGSAIALSIVGDFPELRFEVWGLRQGRLGMNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVAS
LGGIVPRSGSSSTSQAENYKEGLADQAASGNNMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPN
GSNNNIARVQRMPHGISRGLYERPGMLLGAWDNAYIAAAMPLLLLVENIRSWPTRNAAEVRPPIVRELQY
FQQHLQKKNYPQEDINHLSYLLCTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHLRVYMNSPKQ
YREVLEFYDLIMCLGFDGKYQMIEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKI
FTYGFALCLCAYGVTAWYLHQQSQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWL
LIFTSDGAFRTGEATLSEEFINKKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVV
ADKLRESTQINETHQREISAIGRGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEV
QGTNTQQ
 
Nucleotide Sequence: 2964 bp     [Download]
>gi|384124469|ref|NC_017160.1|:547668-550631 Yersinia pestis D182038 chromosome, complete genome
ATGCTGCCAAAACAACGTGTTGCTTGGGTGGAAGGGATGCTGATGGAACCCCAGCATTTTCAACAACAGG
AACGATATCTAGAACATTTAACTGAAATGCGGGCACGTAGCCTCAGCGCGCTGGCATGGGGCTTCCATAG
CCTAAGTATCAATCAAGGGCTGCTGGATCAGGGCAAGATCGCCCTCAATCAGGCCAGTGGTGTTTTCCCT
GACGGTACACCTTTTCATATGGCGGGTGATGAGCCATTACCGCTACCTTTTGATCCGGGGGAGAACTGCC
AAGGCAGTGTCGTGTGCCTTTCGGTCCTGATGGATATACCCGGCAATACCTATATTGATCTGAAGAAGAG
CAACCAAGGTAGCCGTTTCGTTGCGCTGGATGCTGAAGTTCAAGACAGAAACCATGGCGTCGCTGCTGAA
GGAACGCCATTGATCGCCACCCTTCAACTGGGGCAATTGCAATCCAAGCTCACCTTACGTGCCAGCGTCA
GTGATGCAGAATCGATGCTGCCCGTAGCCTATATCAAAGAGCGCACCCGCGATGGGCGTCTGATTCTGGA
TGATAACTTCCTGCCACCCATGTTGGATTTTCGCGCCATAGGGTGGATCGATAATGCGGTAACCGAATTG
CTAGGGTTGATCGTTCAGCGACTGGAATCGGTTTACCGGCCAGATGTGACGCTCTCAGTCGGTGGGTTAT
CGGAGTTACTGGAACTGCTATTACTGCAAACACTCAGTGAATATAACCTAAAGATTTCACATGTGTTGAT
GCAAAAACAGGTACACCCTGAGCAGTTGTTCCAATTATTGCTTGGGTTGTTGGGGCGTCTCAGTACTATC
CCTGGCGGAGAAAAACCGTGGTCGAGGCAGGATCTGCTCTATACGCATCATGAACCGCACAACGGGTATT
TCTCGCTGTTTGCCGCCTTACGGCGCGCACTCTCACTGGTGATCGAAGCACCGGCAGTGGCGCTACCGTT
TATCGAACGTGGCGACAATATTTACCTGTGCCAGAACGATTCACAACTGCGTCTGGAAAAACTGATCTTC
ACCGTCAGTTCCAAACTGCCTTCCGAGACCATTCGCACTTACTTCCCGGCGCAAACCAAACTGGGGCCGG
TGGAGAAAATTGTACAGTTGATCGACCTGCAATTGCCTGGCGCACGGATGATCCCGATGTCATCACCGCC
AAGATATATTCCTTATTACCCGAATAGCGTCTATTTCGAAGTTGACCATGATGATCCTATGTATAAAGAA
ATGATGTCTGGTTCAGCTATCGCACTCAGCATCGTGGGTGATTTCCCTGAGTTGCGTTTTGAAGTATGGG
GCTTGCGACAAGGAAGGCTCGGGATGAACGAATTTGAACGCCAGATCCGTGCAGCCATTTCCGCAGCACG
CAATGGCGCAAAACATGCGGAACAGTCACTGACTACACCAATGTGGCAAGCCAAAAGCACCGTAGCCTCA
TTGGGTGGGATTGTCCCTAGAAGTGGCTCTTCGTCAACGTCACAGGCGGAGAACTATAAGGAAGGTCTCG
CGGACCAGGCTGCCTCGGGCAACAACATGGCGCGCACGAGTGCGCCACCGGTCACTTTGTATCAGCAACA
GCCAAATGCGAATGACAGCTATCCAAACGGGAATAACAACAATCCAAACGGGGATAACAACAATCCAAAC
GGGAGTAACAACAATATAGCGAGAGTACAGCGTATGCCGCATGGCATTTCCAGGGGCTTATATGAGCGCC
CTGGGATGTTATTGGGTGCCTGGGATAACGCCTATATTGCTGCGGCTATGCCTTTGCTGCTGCTGGTGGA
AAATATTCGTAGCTGGCCGACGCGTAACGCCGCAGAGGTCAGGCCACCGATTGTGCGGGAATTACAATAT
TTCCAGCAACATTTGCAGAAAAAGAACTACCCGCAAGAAGACATTAACCACCTGTCTTACCTGCTATGTA
CCTATATCGATGGCATTTTTAACGGGCTGCAAACCCCAGACTCCTACAACCAAAGTCTGTTAGTGGAGTT
TCACCGTGATGCCTGGGGGGGTGAGGACTGCTTCGAACATCTGCGGGTCTATATGAACTCGCCGAAACAG
TACCGGGAAGTTCTGGAATTCTATGATCTGATTATGTGCCTTGGTTTTGACGGTAAATACCAGATGATAG
AGCATGGTGCGGTTCTGCTGATGGATTTACGCAGCCGTCTCCACACGCAACTCTACGGTCAGGACGCCAC
ACAATCTTTGGCTATCGCGCAAGCGGTCAAAGGTTCTCCGCGTCGCCAATATATCAAGGCGCTGAAAATC
TTCACCTATGGTTTCGCACTGTGCCTTTGTGCTTACGGCGTCACGGCGTGGTATCTGCACCAGCAATCCC
AACAGATCCGCAGCAACATTCTGACGTGGGTACTGCCTGAACCGCGGAAAATCAACATCATGGAGACCTT
GCCGAATCCGCTATCCAACATCCTGAATGAAGGGTGGCTGGAGGTCAGGAAAGATCCGCGTGGATGGCTA
TTAATCTTCACCTCCGACGGCGCGTTCCGCACGGGTGAAGCGACCCTCTCGGAAGAGTTTATCAACAAGA
AGAATATCGAACGTCTTGGGCTGGCATTAGCCCCATGGCCGGGAGATATCGAGGTTATTGGTCATACGGA
TAACAAACCGTTCCGTAGCACTTCCGGTAACAACAACCTCAAACTTTCCGCGGCCAGAGCATCGGTGGTG
GCAGATAAACTGCGGGAATCCACTCAAATCAACGAAACCCATCAGCGAGAAATAAGTGCCATCGGACGGG
GGGAGAGCGATCCTTTAGCTGACAATGCAACGGAAGAAGGGCGCAAGCGTAACCGGCGTGTGGATATCCT
ATGGAAAATTGGTCAGCGCGATGCCGATAAGGCCATGAAGCAATTCCTGGAGAACCCAACACCAGAAGTT
CAAGGAACGAATACCCAACAATAG