SecReT6
Protein ID: 384125182
SecReT6 ID574
T6SS typei2
Gene symbol-
Locus tagYPD8_0713
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]920880..922127 [+]
Producthypothetical protein
NoteTssK
UniProt IDD0JQ90
KEGG IDypx:YPD8_0713
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.10E-130, Aligned region: 4..412
Protein Sequence: 415 a.a.     [Download]
>gi|384125182|ref|YP_005507796.1| hypothetical protein YPD8_0713 [Yersinia pestis D182038]
MAVMHPWGVLQATFELDALAQGRLKAARLHVRFQDGVLVDTECADVLPPTLTLAASLPAEASDATVMLAI
PQLYANGGNCLQPDERGERPVRYRQAWRDVQNQFGDDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLR
DAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMRRESNARMADFAVADVSLFWLLNA
LNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLTFSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEA
SLPSRVVAIELVHEPRINQWRATLRDPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNV
ALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAATQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|384124469|ref|NC_017160.1|:920880-922127 Yersinia pestis D182038 chromosome, complete genome
ATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGCCACTTTTGAATTGGATGCATTGGCACAGGGCCGCC
TGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGACGGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCT
GCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCGCCGAGGCCAGCGACGCCACGGTGATGCTGGCGATA
CCACAACTGTATGCCAATGGCGGTAACTGCCTGCAGCCGGATGAGCGGGGCGAACGCCCGGTACGCTATC
GTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGCGATGACAAAAAGCAGGTCGCGGTGATGTACCACCA
ACTGACCCTGCGGCTGGACACTCAGGAAAACGGCGATTATCAGGTCTGCCCGGTGGCGCGTTTGCTGCGG
GATGCGCAAGGTCGCTGGACACTGGATCCGGGCTTTATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCT
GGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAACTGCGGGCGCGTTTGCAGCGTCTGATGGGGATGCG
CCGGGAGAGCAATGCACGGATGGCCGATTTTGCTGTTGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCC
CTTAACAGTGCCGAACCGGTATTGGGGAATTTTCAGCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATC
AGGAACTGGCCAGGCTGGCGGGCAGCCTGCTGACGTTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGT
TTATCAGCATGAACAACTGACCCGCGTCTTTCCCCCGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCC
AGCCTCCCTTCACGGGTAGTGGCGATTGAGCTGGTTCATGAACCGCGTATCAATCAGTGGCGCGCGACCC
TGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTCTACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCA
ATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCGGTGCGCCGGATGAGGTCGGTAACGTGGTGAATGTT
GCGCTGAGTGGGATCCCACTGCGCCCGCTGAGCCATGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACC
AGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCGACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTA
TGTACCCGGTACGCTGGGTGAGATCCAACTGGAGCTGTTTGCGGTGCTACGCGCATGA