SecReT6
Protein ID: 384125752
SecReT6 ID575
T6SS typei2
Gene symbol-
Locus tagYPD8_1288
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]1650682..1651929 [+]
Producthypothetical protein
NoteTssK
UniProt IDD0JTR0
KEGG IDypx:YPD8_1288
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-128, Aligned region: 4..412
Protein Sequence: 415 a.a.     [Download]
>gi|384125752|ref|YP_005508366.1| hypothetical protein YPD8_1288 [Yersinia pestis D182038]
MAVMHPWGVLQATFELDALAQGRLKAARLHVRFQDGVLVDTECADVLPPTLTLAASLPVEASDATVMLAI
PQLYANGGNCLQPDERGERPVRHRQAWRDVQNQFGDDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLR
DAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMRRESNARMADFAVADVSLFWLLNA
LNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLTFSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEA
SLPSRVVAIELVHEPRINQWRATLRDPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNV
ALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAATQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1248 bp     [Download]
>gi|384124469|ref|NC_017160.1|:1650682-1651929 Yersinia pestis D182038 chromosome, complete genome
ATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGCCACTTTTGAATTGGATGCATTGGCACAGGGCCGCC
TGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGACGGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCT
GCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCGTCGAGGCCAGCGACGCCACGGTGATGCTGGCGATA
CCACAACTGTATGCCAATGGCGGTAACTGCCTGCAGCCGGATGAGCGGGGCGAACGCCCGGTACGCCATC
GTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGCGATGACAAAAAGCAGGTCGCGGTGATGTACCACCA
ACTGACCCTGCGGCTGGACACTCAGGAAAACGGCGATTATCAGGTCTGCCCGGTGGCGCGCTTGCTGCGG
GATGCGCAAGGTCGCTGGACACTGGATCCGGGCTTTATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCT
GGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAACTGCGGGCGCGTTTACAGCGTCTGATGGGGATGCG
CCGGGAGAGCAATGCACGGATGGCCGATTTTGCTGTCGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCC
CTTAACAGTGCCGAACCGGTACTGGGGAATTTTCAGCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATC
AGGAGCTGGCCAGGCTGGCGGGCAGCCTGCTGACGTTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGT
TTATCAGCATGAACAACTGACCCGCGTCTTTCCCCCGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCC
AGCCTCCCATCACGGGTGGTGGCGATTGAGCTGGTTCATGAACCGCGTATCAATCAGTGGCGCGCGACCC
TGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTCTACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCA
ATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCGGTGCGCCAGATGAGGTCGGTAACGTGGTGAATGTC
GCGTTGAGCGGGATCCCACTGCGTCCGCTGAGCCATGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACC
AGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCGACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTA
TGTACCCGGTACGCTGGGTGAGATCCAACTGGAGCTGTTTGCGGTGCTACGCGCATGA