SecReT6
Protein ID: 384125756
SecReT6 ID575
T6SS typei2
Gene symbolclpA2
Locus tagYPD8_1292
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]1655260..1656783 [+]
Productputative ATPase subunit of ATP-dependent protease
NoteTssH
UniProt IDD0JTR4
KEGG IDypx:YPD8_1292
PDB IDNA
Domain hit(s) vs Pfam AAA [PF00004], Evalue: 6.10E-11, Aligned region: 30..56
AAA [PF00004], Evalue: 6.10E-11, Aligned region: 171..203
AAA [PF00004], Evalue: 6.10E-11, Aligned region: 240..352
AAA_16 [PF13191], Evalue: 6.20E-08, Aligned region: 153..198
AAA_16 [PF13191], Evalue: 6.20E-08, Aligned region: 217..261
AAA_16 [PF13191], Evalue: 6.20E-08, Aligned region: 285..318
Arch_ATPase [PF01637], Evalue: 2.20E-06, Aligned region: 218..255
Arch_ATPase [PF01637], Evalue: 2.20E-06, Aligned region: 292..392
Clp_N [PF02861], Evalue: 1.50E-05, Aligned region: 23..60
Clp_N [PF02861], Evalue: 1.50E-05, Aligned region: 111..125
AAA_25 [PF13481], Evalue: 3.00E-05, Aligned region: 240..264
AAA_25 [PF13481], Evalue: 3.00E-05, Aligned region: 293..328
NACHT [PF05729], Evalue: 4.60E-05, Aligned region: 240..337
AAA_22 [PF13401], Evalue: 0.00015, Aligned region: 62..101
AAA_22 [PF13401], Evalue: 0.00015, Aligned region: 239..325
IstB_IS21 [PF01695], Evalue: 0.0015, Aligned region: 141..219
IstB_IS21 [PF01695], Evalue: 0.0015, Aligned region: 233..301
AAA_5 [PF07728], Evalue: 0.0066, Aligned region: 240..264
AAA_5 [PF07728], Evalue: 0.0066, Aligned region: 330..370
Protein Sequence: 507 a.a.     [Download]
>gi|384125756|ref|YP_005508370.1| putative ATPase subunit of ATP-dependent protease [Yersinia pestis D182038]
MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLLEQGEGDITVIARRYEWDMDSLWQGL
LAYLDTLPRTVQGKPQLSAALQQLIKSAWLDASLQENADAVRSVHLMAALINSPSLLAADAAWPLLSLST
TRLHRLLPLLDSQSDERPEIQQAAALASTSPVNLTDEAATVTSASGQPQLNDALQAALDKFTLDVTAKAR
ANQIDPIFGRDSEIRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIADGNVPDSLKTVSVRTLDLG
LLQAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAA
TTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGVHILDAAITAAVTLSRRFLTG
RQLPDKAVDLLDTAGARVRMSIDTLPTALMEITPNWPHWRWSNRPSNRTCSCCRMSVQRAYLRLSNAAPR
WRLGSTHSNSNIKKRSG
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|384124469|ref|NC_017160.1|:1655260-1656783 Yersinia pestis D182038 chromosome, complete genome
ATGACAACGCATTCAGCACACTTATTACGCCGCTTAAATCCCTATTGCGCACAGGCACTGGCCGGTGCTG
CCACCCTGTGTCAGACCCGCGCCCATGCCGAGATCACTGTCGAACACTGGTTGTTAAAACTGCTGGAGCA
GGGCGAAGGCGATATCACGGTGATTGCCCGGCGTTATGAGTGGGACATGGACAGCTTGTGGCAAGGGTTA
CTGGCCTATCTGGATACTTTGCCGCGCACGGTACAGGGTAAACCCCAACTGTCCGCCGCGTTGCAGCAAC
TGATCAAAAGTGCCTGGCTGGATGCCTCGTTGCAGGAAAATGCTGATGCGGTGCGCTCGGTTCATCTAAT
GGCAGCGCTGATAAATTCGCCATCATTATTGGCCGCCGATGCCGCCTGGCCGTTGCTCAGCCTGAGCACT
ACCCGACTACACCGCTTGTTGCCGTTGCTGGACAGCCAATCCGACGAACGCCCTGAAATACAGCAGGCTG
CGGCACTGGCTAGTACTAGCCCGGTCAATCTGACCGATGAGGCCGCGACGGTTACCTCCGCCAGTGGTCA
GCCGCAACTGAATGACGCGCTGCAAGCGGCGCTGGATAAATTCACCCTCGACGTCACCGCCAAAGCCCGT
GCCAACCAGATTGACCCGATTTTTGGCCGCGACAGCGAAATCCGCCAGATGATCGACATCCTGTCGCGCC
GCCGTAAAAACAACCCGATTCTGGTGGGTGAACCGGGTGTGGGGAAAACCGCGCTGGTTGAAGGGCTGGC
ACTGCGCATTGCCGACGGCAACGTACCGGACAGCCTGAAAACCGTCAGTGTGCGCACACTGGATTTGGGT
CTGTTACAGGCCGGTGCCGGGGTCAAAGGCGAGTTCGAACAGCGCCTGAAAAATGTTATCGAGGCGGTGC
AACAATCCCCCAGCCCGGTGCTGCTGTTTATCGACGAAGCCCACACCATTATCGGGGCCGGTAATCAGGC
CGGTGGTGCCGATGCGGCCAACCTGCTGAAACCGGCACTGGCGCGTGGCGAACTGCGCACCATCGCCGCC
ACCACCTGGTCCGAATACAAACAGTATTTTGAACGCGATGCCGCACTGGAGCGCCGCTTCCAGATGGTCA
AAGTGGACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGTGGCCTGAAAGAACGTTACGCCACCCA
TCACGGCGTGCATATTCTGGACGCCGCTATCACCGCAGCGGTTACCCTGTCGCGCCGCTTCCTGACCGGC
CGCCAACTGCCGGACAAAGCGGTGGATCTGCTCGATACCGCCGGTGCCCGGGTGCGCATGAGCATTGACA
CCTTGCCGACTGCGTTGATGGAGATTACGCCGAACTGGCCGCACTGGCGATGGAGCAACAGGCCATCGAA
CAGGACTTGCTCCTGCTGCCGAATGTCAGTTCAACGCGCTTACCTGAGATTGAGCAACGCCGCGCCGCGC
TGGCGGTTGGGCAGCACACACTCGAACAGCAATATAAAGAAGAGAAGCGGTTGA