SecReT6
Protein ID: 384125757
SecReT6 ID575
T6SS typei2
Gene symbol-
Locus tagYPD8_1293
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]1656780..1657904 [+]
ProductClp ATPase
NoteTssH
UniProt IDD0JTR5
KEGG IDypx:YPD8_1293
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-40, Aligned region: 105..269
ClpB_D2-small [PF10431], Evalue: 3.40E-15, Aligned region: 84..94
ClpB_D2-small [PF10431], Evalue: 3.40E-15, Aligned region: 276..354
AAA_5 [PF07728], Evalue: 8.70E-11, Aligned region: 109..230
AAA_5 [PF07728], Evalue: 8.70E-11, Aligned region: 236..261
AAA [PF00004], Evalue: 8.60E-08, Aligned region: 110..228
AAA [PF00004], Evalue: 8.60E-08, Aligned region: 258..275
AAA_16 [PF13191], Evalue: 1.30E-07, Aligned region: 81..153
AAA_16 [PF13191], Evalue: 1.30E-07, Aligned region: 174..204
AAA_16 [PF13191], Evalue: 1.30E-07, Aligned region: 247..292
Sigma54_activat [PF00158], Evalue: 0.00019, Aligned region: 19..47
Sigma54_activat [PF00158], Evalue: 0.00019, Aligned region: 109..226
Zeta_toxin [PF06414], Evalue: 0.0014, Aligned region: 108..149
AAA_14 [PF13173], Evalue: 0.0026, Aligned region: 108..199
AAA_22 [PF13401], Evalue: 0.0045, Aligned region: 108..130
AAA_22 [PF13401], Evalue: 0.0045, Aligned region: 171..203
Protein Sequence: 374 a.a.     [Download]
>gi|384125757|ref|YP_005508371.1| Clp ATPase [Yersinia pestis D182038]
MTTLIIEARQDIANAAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGVPLGSLLKDEQTNLLSL
ENRLGERVIGQDAALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETALALADSLFGGEKSLITI
NLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVLNLFYQVFDRGFMRDG
EGREIDFRNTVIVMTANLGSDHLMQLLDEQPDAPDSTLHELLRPILRDHFQPALLARFQTLIYRPLQVDA
LKRIVAIKLNQVAQRLHCHYGLSCQIEDSLTDTLVAACLLPDTGARNIDSLLNQQILPVLSQQLLSRMSE
QQRTTSLTLGWHEEDGITLTFEGE
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|384124469|ref|NC_017160.1|:1656780-1657904 Yersinia pestis D182038 chromosome, complete genome
TTGACCACCCTGATTATTGAGGCGCGTCAGGACATCGCCAACGCAGCACATCTGGTCGCGTTGCAGGAGG
AACTCGTTCAGATTCAGGGCAATGCGCCGCTGTTGTCGCTGGACGTTGATGTGCGCACTGTTGCGGCTGT
GATCGCCGACTGGACCGGTGTGCCGCTGGGCAGTTTACTCAAAGACGAACAAACCAACTTGCTGTCACTG
GAAAATCGTCTGGGTGAGCGAGTGATTGGGCAGGATGCGGCATTAGGTGCGCTGGCGCAACGGCTGCGGG
CCGCCAAAACCGGCCTGACATCAGAGAATGGCCCGCTGGGGGTGTTCCTGCTGGTCGGGCCGAGTGGGAT
CGGCAAAACCGAAACCGCGTTGGCACTGGCCGACAGCCTGTTCGGCGGGGAAAAATCGCTGATCACCATC
AACTTATCGGAGTATCAGGAAGCGCACACCGTCTCCCAGTTGAAAGGGTCGCCCCCGGGTTATGTCGGTT
ACGGACAGGGCGGCGTATTAACCGAAGCGGTACGTAAACGGCCTTACAGCGTGGTGCTGCTGGATGAAGT
GGAAAAAGCCCATCGTGATGTGCTGAACCTGTTCTATCAGGTGTTTGACCGGGGGTTCATGCGCGACGGT
GAAGGGCGCGAAATTGATTTCCGCAACACGGTCATTGTGATGACCGCCAATCTGGGCAGTGATCATCTGA
TGCAGTTGCTGGATGAGCAACCGGACGCGCCGGACAGCACCCTGCATGAACTGCTGCGGCCGATCCTACG
CGACCACTTCCAGCCCGCGCTGCTGGCCCGCTTCCAGACCTTGATTTACCGCCCGCTTCAGGTGGATGCG
CTCAAACGCATTGTGGCGATAAAACTGAATCAGGTGGCGCAACGCCTGCACTGTCACTACGGCCTGAGCT
GCCAGATTGAAGACAGCCTGACCGACACACTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCACGCAA
CATCGACAGCCTGCTCAATCAGCAGATTTTACCGGTATTGAGCCAGCAGCTGTTAAGCCGCATGAGCGAG
CAACAGCGCACCACCTCGCTGACGCTGGGCTGGCATGAAGAAGATGGCATCACGCTGACATTTGAGGGCG
AATAA