SecReT6
Protein ID: 384125772
SecReT6 ID575
T6SS typei2
Gene symbol-
Locus tagYPD8_1308
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]1681928..1683691 [+]
Producthypothetical protein
NoteTssF
UniProt IDD0JTT0
KEGG IDypx:YPD8_1308
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-183, Aligned region: 6..583
Protein Sequence: 587 a.a.     [Download]
>gi|384125772|ref|YP_005508386.1| hypothetical protein YPD8_1308 [Yersinia pestis D182038]
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSIVEFTPQWQGMKERMGVSKGFEVLSRPIGERETRCRYTTTQEMDLLPLT
LRRAGLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYFDADAPLACALHEALTLNTAKLWIRLPGQAD
RQPLDGHFAPLGFGEQDTLWPKADSAFSGYQLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLE
KRWQHDFSFSEKNLRLHCVPVINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQ
VYVPFTSFRHKGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAEVLRGTLALYD
WTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGDICLFGEMLSRFFALYTDIHL
FNRLTLILQPTGERLEWEENHQSRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|384124469|ref|NC_017160.1|:1681928-1683691 Yersinia pestis D182038 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTTTGACGCTGAAATGCGCTACCTGCGCGAAGCGGGCGAAGAGTTTG
CTCGTGCGCACCCTGATCGGGCTGCCGGATTAAATCTGGATAAAGCCGGGGCGCGTGACCCCTATGTCGA
ACGCCTATTTGAAGGCTTTGCCTTTCTGATGGGCCGACTGCGGGAAAAACTGGATGACGACCTGCCGGAA
CTGACCGAAGGGTTGGTCAGCCTGCTGTGGCCGCACTACCTGCGTACCATTCCGTCGCTTTCTATTGTGG
AGTTCACCCCACAATGGCAGGGGATGAAAGAGCGCATGGGGGTGAGTAAAGGTTTTGAAGTGCTGTCCCG
CCCCATTGGTGAACGTGAAACCCGTTGCCGCTATACCACCACGCAAGAGATGGACCTGCTCCCGCTGACC
CTGCGCCGTGCCGGGCTGGACAGTGAACCCGATGGCCGGTCGGTTATCCGGCTGCGCTTTGATTGCAGCG
CGCTGGCCGACTGGAGCCGTATCAACCTGAGCCGCCTGCCGCTCTATTTTGATGCCGATGCGCCGCTGGC
CTGCGCCCTGCATGAGGCGCTGACCCTGAATACCGCCAAACTCTGGATCCGTTTGCCGGGGCAGGCTGAT
CGCCAGCCGCTGGACGGCCATTTCGCGCCGCTGGGGTTCGGGGAGCAGGATACACTGTGGCCGAAGGCCG
ACAGTGCGTTCAGTGGTTATCAGCTCTTGCTGGAGTACTTTACCTTCCGCGAAAAGTTTATGTTTGTCGC
GTTGCAGGGGCTGGATGGGATCGAGCTGCCGGCGGAACTGCCGTGGTTTGAGATTGATGTGGTGCTGGAA
AAACGCTGGCAACATGATTTCTCGTTCTCCGAAAAGAACCTGCGCCTGCATTGTGTGCCGGTGATTAACC
TGTTCCCGCTGGAATCGGACCCGCTGTCACTTTCTTCATTACAGACCGAATACCTGCTGCGCCCAATGCG
CATTCAGGACGGTTATACCGAAGTGTATTCGGTGGACTCGGTGATCTCCTCCCGTCATACCGGGCATCAG
GTCTATGTCCCTTTCACCAGCTTTCGCCACAAGGGGGGGATGTTGCGCCATGATGCGCCGGAGTATTACT
ACCATACGCGGGTCAAACGCGGGCCTTCGGGGTTACACGATACCTGGCTGGTGCTGGGGGGCGAGGCGTT
TGATAACCACAGCGTACCGGATAATGAAAATTTGTCGCTGAGCCTGACCGGCACCAACGGGCAGTTACCG
CGTAAAGCGCTGCAAAGCACGGTGCTGGATACGGCGGTGAAATCCACCGGGGCTCAGGTGCGGGTGCGTA
ATCTCTCCGCGCCGTCATTGCCATGCTACCCGCCGAACCGCGACCGTTTTCACTGGCGGGTGCTGAGCCA
TCTGGGCAGTAGTTTTCTGTGGATGATGGATAACGCCGAAGTGCTGCGCGGCACGCTGGCGCTGTATGAC
TGGACGGACAACGAAATGAACCGCCGTCGGCTGGAGGCGATCGCCGAGGTCAAACACAGCGAGATTGAAC
GCTTTGAGCGGGGCTATTTGCTGCGCGGGGTGCACATTGAAATCACCCTCGACAGCAACGGCTTTACCGG
TACCGGGGATATTTGTCTGTTTGGGGAAATGCTCAGTCGCTTCTTTGCCCTGTATACCGATATTCACCTG
TTTAATCGTCTGACTCTGATACTGCAACCGACAGGAGAACGTTTGGAATGGGAAGAGAATCATCAGTCCC
GCCTTCCCGGCTAA