SecReT6
Protein ID: 384125773
SecReT6 ID575
T6SS typei2
Gene symbol-
Locus tagYPD8_1309
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]1683655..1684740 [+]
Producthypothetical protein
NoteTssG
UniProt IDD0JTT1
KEGG IDypx:YPD8_1309
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-81, Aligned region: 19..319
Protein Sequence: 361 a.a.     [Download]
>gi|384125773|ref|YP_005508387.1| hypothetical protein YPD8_1309 [Yersinia pestis D182038]
MGRESSVPPSRLITRLKRDIGQINFYRFCQLLEQQPGTLPLGSTNSPADDPVRFRPHPGMGFPVSELKAL
ENDPLHPEAPLTARTTFMGLYGVDSPLPTAYIDDITQQREGHEALEGFLDIFNHRFMTQFYRIWRKYSYP
ATFESGGTDNTSQSLLGLIGMGIPGSQQHFATPTSRFLALLGVMRQPGRTAEGVQALVRLLAPFTEADVT
PHCLRTVRLTSPMAFADEGANWLDGYTVLGDEAIDANSQLLISLRTADRDEAANWLPDGPLYTDFLVLLR
VYLGWRYRACIQLTVATRLLPALVLDETPIRLGLTGVLGLDDATLSDDIPEYFTVALGHYRGLAPQQHQE
GNRRVNYRLEK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|384124469|ref|NC_017160.1|:1683655-1684740 Yersinia pestis D182038 chromosome, complete genome
ATGGGAAGAGAATCATCAGTCCCGCCTTCCCGGCTAATCACCCGGCTTAAGCGCGATATCGGCCAGATCA
ATTTTTACCGTTTCTGTCAGTTGCTGGAGCAACAACCGGGAACCTTGCCGCTCGGCAGTACCAACAGCCC
GGCGGATGATCCGGTGCGTTTTCGTCCGCATCCCGGCATGGGTTTTCCGGTCAGTGAACTGAAGGCGCTG
GAAAACGACCCGCTGCATCCGGAAGCCCCGTTGACCGCGCGCACCACCTTTATGGGGTTGTACGGGGTGG
ATTCGCCTTTGCCGACGGCCTATATCGACGATATCACCCAGCAGCGCGAAGGGCATGAGGCGCTGGAAGG
GTTCCTCGATATTTTCAACCACCGTTTTATGACGCAGTTTTATCGCATCTGGCGCAAATATTCCTATCCG
GCCACTTTTGAGTCGGGCGGCACAGACAATACCTCTCAGAGCCTGTTGGGGCTGATAGGCATGGGTATTC
CTGGCTCACAGCAGCATTTTGCCACCCCGACATCGCGCTTTCTGGCCTTGCTGGGGGTGATGCGACAACC
GGGGCGCACTGCCGAAGGGGTACAGGCGCTGGTCCGGCTGCTGGCCCCGTTTACCGAGGCGGATGTCACG
CCCCATTGCCTGCGCACGGTGCGCCTGACTTCTCCGATGGCGTTTGCCGATGAAGGGGCCAACTGGCTGG
ACGGCTACACCGTGCTGGGTGATGAGGCCATTGATGCCAACAGTCAGTTGCTGATTTCGCTGCGCACGGC
AGACCGCGACGAGGCCGCTAACTGGTTACCGGATGGCCCGCTGTATACCGATTTTCTGGTGCTGTTGCGG
GTCTATCTGGGCTGGCGTTACCGGGCCTGTATCCAACTGACGGTCGCCACCCGGTTGCTGCCGGCGTTGG
TGTTGGATGAGACACCGATAAGGCTGGGATTAACCGGCGTGCTGGGGCTGGATGACGCGACGCTGTCAGA
CGATATACCTGAATATTTTACCGTGGCGCTGGGCCACTACCGTGGGCTGGCTCCACAGCAACATCAAGAA
GGAAACCGACGTGTTAACTACCGTTTGGAAAAATAA