SecReT6
Protein ID: 384125774
SecReT6 ID575
T6SS typei2
Gene symbol-
Locus tagYPD8_1310
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]1684715..1685296 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD0JTT2
KEGG IDypx:YPD8_1310
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-39, Aligned region: 31..186
Protein Sequence: 193 a.a.     [Download]
>gi|384125774|ref|YP_005508388.1| hypothetical protein YPD8_1310 [Yersinia pestis D182038]
MLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGCGLTQAVTDSTVSATKSLFYKQIKVLHLDFTARE
ALNTDAHEANSSSEPVMVRVYQLRDDKTFLKTVYQQLASDGEAALKDDLLASRSVVVKPGGAVTLDMPME
KETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPRTLELGNNSLTLRTEKK
 
Nucleotide Sequence: 582 bp     [Download]
>gi|384124469|ref|NC_017160.1|:1684715-1685296 Yersinia pestis D182038 chromosome, complete genome
GTGTTAACTACCGTTTGGAAAAATAAAACCTGTACTTCGAAACATAAAAGCTGGGCCGCCTGGAAAAATA
AAATCTGCATCCCCGCACTGGTCTTGTTGCTCAGTGGCTGCGGGCTGACGCAAGCCGTGACCGATAGCAC
CGTGTCGGCCACAAAATCACTGTTTTATAAGCAGATAAAGGTGCTGCATCTGGACTTTACCGCCCGTGAA
GCCCTGAATACCGATGCGCACGAGGCGAACTCGTCATCGGAGCCGGTAATGGTGCGGGTTTATCAGTTAC
GTGATGATAAAACCTTCCTCAAAACGGTGTATCAACAACTGGCAAGCGACGGGGAGGCGGCGCTTAAAGA
TGACCTGCTGGCCAGCCGCAGTGTGGTGGTGAAACCGGGCGGGGCGGTAACACTGGATATGCCGATGGAA
AAAGAGACCCAGTTTGTGGCAGTGGTGGCGCTGTTCCGTCATCCGGATATGGCCAAAGACCACTGGCGTC
TGATACTCACGCTGGACGACCTGCATCCCGATAAGCCCCGTACCCTTGAGTTGGGTAATAACAGCCTGAC
CCTGCGGACGGAGAAAAAATAA