SecReT6
Protein ID: 384125775
SecReT6 ID575
T6SS typei2
Gene symbol-
Locus tagYPD8_1311
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]1685296..1685748 [+]
Producthypothetical protein
NoteTssE
UniProt IDD0JTT3
KEGG IDypx:YPD8_1311
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-14, Aligned region: 31..116
Protein Sequence: 150 a.a.     [Download]
>gi|384125775|ref|YP_005508389.1| hypothetical protein YPD8_1311 [Yersinia pestis D182038]
MPDTSSPSLYEQLLGNFTGGLDLHQVSDENQVILSVLDNMQRILNCRAGTLSHLPDYGLPDMSKILQGLP
GSAHSLLTTLSATLLKYEPRLKSLQVILLPQTTPGHLEYAIDAELKGLGLVRYGTAFMPEGRVLMRHLKQ
QHYLNQRESF
 
Nucleotide Sequence: 453 bp     [Download]
>gi|384124469|ref|NC_017160.1|:1685296-1685748 Yersinia pestis D182038 chromosome, complete genome
ATGCCGGATACCTCCTCGCCGTCACTGTATGAGCAATTGCTGGGCAATTTCACCGGCGGGCTTGACCTGC
ATCAGGTCAGTGACGAAAACCAGGTCATTCTCTCGGTGCTGGACAATATGCAGCGCATTCTTAATTGTCG
GGCCGGAACACTCAGTCATCTGCCCGATTATGGCCTGCCGGACATGAGTAAAATTCTGCAGGGGTTGCCG
GGCAGCGCGCATTCGCTGCTGACCACGCTGTCCGCCACCTTGCTGAAGTACGAGCCGCGTCTGAAAAGTT
TGCAGGTGATTCTGTTGCCACAGACCACACCCGGTCATCTGGAATACGCCATTGATGCGGAGCTGAAAGG
GCTGGGACTGGTGCGCTATGGCACGGCGTTTATGCCGGAGGGCCGGGTGCTGATGCGCCACCTTAAACAA
CAACACTACCTCAATCAGCGGGAGTCATTTTGA