SecReT6
Protein ID: 384127008
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2556
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3244973..3245779 [-]
Producthypothetical protein
NoteTagJ
UniProt IDD0JNZ7
KEGG IDypx:YPD8_2556
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.00E-45, Aligned region: 145..263
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 47..76
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 105..136
Protein Sequence: 268 a.a.     [Download]
>gi|384127008|ref|YP_005509622.1| hypothetical protein YPD8_2556 [Yersinia pestis D182038]
MNTTNLTELLKSASLTEMLADVIATIKAKPTDTDTRELLFKLYCIDGSWQKALLQLETLTQLLPEFTKQA
ELYKNLILSEKMRDEVLAGKRSPGTLGNDLPEWVALLQQANQLHHDGDHQQSEALREQALQQAPESIGES
AATGCFAWIADSDGRMGPVCEFISAGGYRWIPFAEIQSLTVSKPKNITDLIWAPAQVKVKDKVWYGYIPA
RYPLTPETDNETKLGLKTEWHQPTDSLYIGAGRKMFITDQGEHALFDIEEIVFEIDCI
 
Nucleotide Sequence: 807 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c3245779-3244973 Yersinia pestis D182038 chromosome, complete genome
ATGAATACCACGAATTTAACTGAGTTATTAAAAAGCGCGTCTTTAACCGAAATGCTGGCCGATGTCATTG
CTACGATAAAAGCTAAACCAACGGACACCGATACGCGAGAACTGTTATTCAAACTCTATTGTATTGATGG
TTCATGGCAAAAAGCCCTATTGCAGCTTGAAACATTGACACAGCTTTTACCTGAGTTCACCAAACAGGCT
GAACTCTATAAAAATCTGATATTGAGTGAGAAAATGCGTGATGAAGTGCTGGCAGGCAAACGCAGCCCTG
GTACATTGGGTAACGACCTGCCTGAATGGGTAGCCTTGTTGCAACAAGCTAATCAACTCCACCATGATGG
CGATCATCAGCAAAGTGAGGCCCTCCGTGAACAGGCTCTGCAACAGGCACCGGAAAGTATCGGAGAGAGT
GCTGCGACAGGCTGCTTCGCTTGGATTGCTGACAGTGATGGGCGCATGGGGCCTGTTTGTGAGTTTATTA
GCGCCGGCGGTTACCGTTGGATCCCGTTTGCAGAGATACAATCACTCACTGTTTCCAAACCTAAAAATAT
TACAGACCTGATATGGGCGCCGGCACAGGTTAAAGTAAAGGATAAAGTTTGGTACGGTTATATACCTGCC
CGCTATCCACTGACACCTGAAACAGACAATGAAACTAAACTGGGTCTTAAAACAGAATGGCATCAACCGA
CTGACTCACTTTATATTGGGGCAGGGCGGAAAATGTTTATCACCGACCAAGGTGAGCATGCGCTGTTTGA
TATTGAAGAGATTGTATTTGAGATAGATTGTATTTGA