SecReT6
Protein ID: 384127010
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2558
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3247006..3249468 [-]
Producthypothetical protein
NoteTssI
UniProt IDD0JNZ9
KEGG IDypx:YPD8_2558
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.10E-76, Aligned region: 18..336
Phage_base_V [PF04717], Evalue: 3.40E-24, Aligned region: 376..469
Protein Sequence: 820 a.a.     [Download]
>gi|384127010|ref|YP_005509624.1| hypothetical protein YPD8_2558 [Yersinia pestis D182038]
MPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTIEMELDGNGLGD
VRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDIIEEVFSDYNFPF
EKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRSFSTAYHAIEYL
SDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHWPGDYDQPDIGE
HLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSGGEDAFSC
ESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGTNSESDSCWLRV
SQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGMVSRTVGGGLTN
YNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDVLGTSMLAIGAA
SMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATLAAGGPIAIGAG
GELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGAIALPLPLPLLP
IVVPPVTSPPDPTVPPDPTLPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPETTAPP
ETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPEPTRTPPGTQTPPP
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c3249468-3247006 Yersinia pestis D182038 chromosome, complete genome
ATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGTCTAAGTTGGAAGGCGAGGAAGCCTTTTCGACTT
TATATTCTTATACTATTACGGCAAAGACACCGGCTAACCCATTAATTCCTTGGCAAGCGGCTTCAAATGT
CGATCTCAAATCCTTAATTGGTAAAGAGATGACGATTGAAATGGAACTGGACGGCAACGGCCTGGGTGAT
GTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGGGGCTGGTTGAGAGAGCCAGATACATTGGTCGAG
ATGCCAATCAGGCCATATTTGAGATCACTATTAAGCCTTGGTTCTACCTGGCTAATTTAACCTCTGACTT
TAAAATTTATCAAAATAAAAATGTCGTTGATATTATAGAGGAAGTGTTCTCAGACTATAATTTTCCGTTT
GAGAAACGGTTGGCTACAACCTATCCGATATTAGATTTTCAGGTTCAGTACGGTGAAACCGACTTTAATT
TCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTGGTTCTTTGAGCATCAGGATCATAAACAAAAATT
AATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCGTTCAGTACCGCCTACCATGCCATTGAGTACTTG
TCGGATGAGCCTAAAGCGGGCGAAGAGTACATCACACAATTCCAGACTCAGGAAACCTTGACGAGTGGGA
CCTGGGTCACCAACGATTATGACTTCACGAAATCCCGTGCCGATATTCTGGCAATGGACAGTAAACCGCG
TAAAACCAGCTTTAACGATCTCGAGATTTATCACTGGCCAGGGGATTATGATCAGCCAGATATTGGTGAG
CACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTCTGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGC
GCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGGGTTCCCCGTTGATAAAGCGAATCGGGAATACAT
GATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGATCAACTGTCTGGCGGTGAGGATGCGTTTAGTTGC
GAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCTATCGTCACCCACAGGTGACACCAAAACCGAAAA
CCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACCGGGTGAAGAGATTTGGACCGATGAATATGGCCG
CGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACAAACAGCGAGTCAGACTCTTGCTGGCTACGTGTT
AGCCAGGCTTGGGCAGGGAACAGCTTTGGTGGGATCTATATTCCACGCATTGGTCAGGAAGTCATTGTTG
ACTGTATTAACGGCGATCCTGACCGGCCAATGGTGATGGGCAGCCTTTATAATAACGTGACGCGTCCCCC
TTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATGGTCAGTCGTACCGTTGGCGGCGGGTTAACCAAC
TATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGGAGCAGTACTGGGAACAGGCCGAGCGCGATATGT
CGCGTTTGACTAAAAATAATGAAACGCAAATTATCGGTGCCGATTCTGTCCTGAATGTAGGGGCCAACCG
AAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTTCTTGGCACATCAATGTTAGCCATCGGTGCAGCC
TCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGGTTGGCGGAGCACATTCACTGAATGTGGTTTTGG
CGAATGCCACCAATGTGGGTGGCGCTAACATGACCAACGTAGGGGGGTTTAATGGCCTTGCGGTGGGGGG
AGCCCATCAGACAGCTGTAGGCGGTGCTGCGACACTGGCTGCCGGCGGCCCTATTGCTATTGGGGCGGGT
GGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTGTTGGTAAAAGTAAGGTTATTATTCAGGGCGGTG
AAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAAAACGGGCAATGGCGGCGGGGCATTCGGTGCCTT
TGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCTATTGCCTTACCGCTACCGTTACCCTTGTTGCCA
ATAGTGGTGCCACCAGTGACATCGCCACCGGATCCAACAGTGCCACCGGATCCGACATTGCCACCGGATC
CGACATTGCCACCAGATCCAACGTTGCCACCAGATCCAACGTTACCGCCGGAAACCACGGCACCGCCGGA
AACCACGGCACCGCCGGAAACCACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCCG
GAAACCACGGCACCGCCGGAAACAACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGC
CAGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAACCGACGCGAACACCGCCAGGGACGCAGAC
GCCACCGCCTTGA